Recombinant Porphyromonas gingivalis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role of PG0026 in P. gingivalis

PG0026 is identified as a novel C-terminal signal peptidase responsible for cleaving the C-terminal domain (CTD) signal peptides of virulence factors such as gingipains, which are critical for P. gingivalis pathogenicity . Key features include:

  • Catalytic Activity: PG0026 cleaves CTD signals after secretion, enabling protein maturation and surface localization of virulence factors .

  • Secretion System: Part of a non-classical Type IX secretion system (T9SS) unique to Bacteroidetes, facilitating the transport of CTD-containing proteins across the outer membrane .

  • Genetic Essentiality: Knockout mutants of PG0026 result in defective processing of CTD proteins, impairing bacterial virulence .

Recombinant Applications and Research Findings

Recombinant studies focus on PG0026’s role in virulence and host interactions:

Table 1: Key Findings from PG0026 Studies

ParameterObservationSource
Enzyme ActivityCleaves CTD signals of gingipains (RgpA, RgpB, Kgp) post-secretion
Genetic Knockout EffectsLoss of PG0026 disrupts O-deacylation of LPS and gingipain surface exposure
Host Immune EvasionPG0026-processed gingipains degrade host immune proteins (e.g., complement)
Therapeutic TargetingPotential vaccine candidate due to its role in virulence

Implications for Periodontal Disease

PG0026-processed virulence factors contribute to periodontal pathogenesis by:

  • Immune Modulation: Gingipains degrade cytokines (e.g., IL-8) and complement components, impairing neutrophil recruitment .

  • Biofilm Formation: PG0026-deficient mutants show altered LPS O-antigen chains, reducing biofilm stability .

  • Systemic Effects: P. gingivalis LPS and gingipains promote atherosclerosis via TLR2/4 activation .

Research Gaps and Future Directions

  • Structural Studies: High-resolution structures of PG0026 are needed to design inhibitors.

  • Recombinant Expression: Limited data exist on recombinant PG0026 production; further optimization could aid functional assays.

  • Therapeutic Potential: Targeting PG0026 with monoclonal antibodies or small-molecule inhibitors may disrupt P. gingivalis pathogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this need in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
lspA; PGN_0515; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Target Names
lspA
Target Protein Sequence
MASFLSRLPQGKVVAALIVLLLVVDQVIKIWVKTTMVLGQSHVVAPWFQIHFVENPGMAF GIELGSKLFLSLFRIVAMGFCIYLLAKLVRKREHTLAFLSCLSLIIAGGIGNIIDSIFYG VIFSGSHGQIAQLFPSGGGYETWFHGRVVDMFYFPLIEGVFPSWLPFWGGEEFVFFHPVF NFADSCISIGLILLLVCYPRTVSLLLDGKKTLPEGTTEDSEPTKRE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.