Recombinant Porphyromonas gingivalis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yidC; PG_0526; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-627
Protein Length
full length protein
Species
Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Target Names
yidC
Target Protein Sequence
MDKNTVIGLVLIGLVIFGFSWLNRPDPQEIEAQRKAAIEAARQDSIAKAEAELLAARTQG ATPDSIKQAAGYNQYGLLAAATAGAEEQVELANGKIALKLSTKGGAIREVLLRDYKTHDG KPLYLFREGESDFNLPLRTVDNRLVDTRDLYFSPISRTDSSVVMRLAVDSASYLDLAYVL LPDDYRLRMTVSGQNLQSLFPANMTMQDLEWSQRIRRQEKSWKFENQYTSIYYKYSGDEV DRLSDSKQEDKKTLEEPLHWVSFKDKYFASVLVCDSYFENNKLAQKTAAAGSDYLKNCTM SATFPLDVRSGTKARFTFFFGPLKYNMLRAYDKGMKAEDNLDLDHLVYLGASIFRWINRY MIIPASTFLQQYFSNWGLIILLLTLGIKLLISPLAYKGYLSSAKMRLLRPQVQEINAKYP GKDQESMMKRQSATMNLYRAAGAGPMSGCLPMLLQFPFLIAMYMYFPTTIDIRQQSFLWA EDLSSYDAVFSWTADIPLLSQFYGNHVSLFCLLMSISNILYIRYTMNQSDTGQEGMAMLK WMPYITTVMFLFFFNQNASGLCYYYFLSSIITVIQYMSSRFIINEEKLMAKLEANKTKPR KKSKWMARLEEAQRQQEAMRRQQQKRK
Uniprot No.

Target Background

Function
YidC, also known as the membrane protein insertase, is essential for the insertion and proper folding of integral membrane proteins into the membrane. It plays a crucial role in integrating both Sec-dependent and Sec-independent membrane proteins, as well as certain lipoproteins. YidC assists in the folding of multispanning membrane proteins, ensuring their correct conformation and function within the membrane.
Database Links

KEGG: pgi:PG_0526

STRING: 242619.PG0526

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of membrane protein insertase YidC in Porphyromonas gingivalis?

YidC in P. gingivalis, similar to its homolog in E. coli, likely functions as a membrane protein insertase involved in the biogenesis of integral membrane proteins (IMPs). Based on comparative analysis with E. coli YidC, it likely plays essential roles in the insertion, folding, and assembly of various membrane proteins, particularly components of respiratory chain complexes . In E. coli, YidC depletion affects the proton motive force (PMF) by impairing the functional assembly of cytochrome o oxidase and F1Fo ATPase complexes . Given P. gingivalis's anaerobic nature, YidC may be crucial for the assembly of its specific membrane protein complexes involved in virulence and survival.

How is the structure of P. gingivalis YidC characterized?

While specific structural data for P. gingivalis YidC is limited in the current literature, structural models can be predicted based on evolutionary co-variation analysis approaches similar to those used for E. coli YidC . A computational approach for YidC structural determination involves:

  • Construction of multiple sequence alignments excluding non-conserved regions

  • Computation of direct evolutionary couplings between pairs of residues

  • Analysis of coupling strength matrices to identify structural patterns

  • Validation using lipid-versus-protein-exposure analysis

  • Refinement with molecular dynamics simulations

These methods reveal characteristic diagonal and anti-diagonal patterns of stronger coupling coefficients, which inform structural predictions.

What expression systems are suitable for recombinant P. gingivalis YidC production?

Based on methodologies used for similar membrane proteins, recombinant P. gingivalis YidC can be expressed using:

  • E. coli BL21 Star expression system: This system has been successfully used for expressing membrane proteins with either hexahistidine (His) tags or glutathione-S-transferase (GST) tags .

  • Purification methods:

    • His-tagged proteins can be purified by immobilized metal ion chromatography using nickel-charged resin

    • GST-tagged proteins can be purified through affinity chromatography using glutathione agarose resin, with the option of tag removal using PreScission Protease

  • Wheat germ cell-free translation system: This has proven effective for synthesizing recombinant membrane proteins from P. gingivalis, enabling production of properly folded proteins without cellular toxicity issues .

How does YidC depletion affect the membrane integrity and proton motive force in P. gingivalis?

Drawing parallels from E. coli studies, YidC depletion would likely lead to:

  • Disruption of PMF: In E. coli, YidC depletion reduces TPP+ uptake, indicating PMF dissipation . Similar effects may occur in P. gingivalis, though the exact magnitude may differ due to its anaerobic lifestyle.

  • Stress response induction: YidC depletion in E. coli induces a specific stress response with increased expression of PspA (phage shock protein A) . A comparable stress response system might exist in P. gingivalis.

  • Respiratory chain defects: YidC depletion in E. coli affects the functional assembly of respiratory chain complexes . In P. gingivalis, similar defects would likely occur in its anaerobic respiratory components.

  • Cell envelope integrity issues: The membrane integrity would likely be compromised, potentially affecting virulence factor secretion and surface structure assembly.

What is the relationship between YidC and the Sec translocase in P. gingivalis?

While specific data for P. gingivalis is limited, by extrapolating from E. coli research:

  • Physical association: A portion of YidC is likely physically associated with the Sec translocase , forming a functional complex for coordinated protein insertion.

  • Complementary functions: YidC may function both independently and in cooperation with the Sec machinery for different substrate proteins.

  • Impact on translocase composition: YidC depletion in E. coli initially has minimal effect on the levels of SecY, SecE, SecD, and SecF, though prolonged depletion slightly decreases SecE, SecD, and SecF levels . Similar relationships may exist in P. gingivalis.

  • Potential pathogenicity implications: Given P. gingivalis's virulence factors often include membrane or secreted proteins, disruptions in the YidC-Sec system could significantly impact pathogenicity.

How does YidC interact with the virulence factors of P. gingivalis?

P. gingivalis produces several key virulence factors that may require YidC for proper membrane insertion or assembly:

  • Gingipains processing and assembly: Arginine (RgpA/B) and lysine (Kgp) gingipains are critical virulence factors in P. gingivalis . YidC may be involved in the proper assembly of these proteases or their secretion machinery.

  • Fimbriae biogenesis: Mfa1 fimbriae, which consist of Mfa1-5 proteins, are important for biofilm formation and require proper membrane processing . YidC could play a role in the membrane steps of fimbrial assembly.

  • Membrane integrity for secretion systems: YidC may influence the assembly of secretion machinery needed for virulence factor export.

What are effective strategies for generating YidC-depleted P. gingivalis strains for functional studies?

To create controlled YidC depletion systems in P. gingivalis:

  • Inducible expression system: Adapt an arabinose-inducible system similar to the one used for E. coli (JS7131 strain) , where cells grown with glucose instead of arabinose experience YidC depletion.

  • Construction method:

    • Clone the P. gingivalis yidC gene under an inducible promoter

    • Delete the native yidC gene or create a conditional mutant

    • Verify depletion by immunoblotting at various time points post-induction cessation

  • Controls for depletion effects: Include growth in the absence of sugars as a control to distinguish between direct effects of YidC depletion and potential metabolic effects from growth media differences .

  • Phenotypic verification:

    • Monitor growth rates

    • Assess membrane integrity

    • Measure proton motive force using TPP+ uptake assays

    • Analyze expression of stress response markers

What techniques are most effective for determining YidC-substrate interactions in P. gingivalis?

Several complementary approaches can identify YidC substrates:

  • Co-immunoprecipitation:

    • Express epitope-tagged YidC

    • Cross-link in vivo to capture transient interactions

    • Immunoprecipitate and identify interacting proteins by mass spectrometry

  • Comparative proteomics:

    • Compare membrane proteome profiles between wild-type and YidC-depleted strains

    • Proteins diminished in the membrane fraction of YidC-depleted cells are potential substrates

  • Site-specific photo-crosslinking:

    • Introduce photoreactive amino acids at specific positions in YidC

    • Identify crosslinked partners by mass spectrometry

  • Bacterial two-hybrid assays:

    • Screen for interactions between YidC and candidate substrates

    • Verify with in vitro binding assays using purified components

How can researchers express and purify functional recombinant P. gingivalis YidC for structural studies?

A detailed protocol for expression and purification would include:

  • Construct optimization:

    • Codon-optimize the P. gingivalis yidC sequence for the expression host

    • Include a cleavable affinity tag (His6 or GST)

    • Consider fusion partners that enhance solubility

  • Expression system selection:

    • Membrane protein expression systems like C43(DE3) E. coli

    • Wheat germ cell-free translation system, which has proven successful for P. gingivalis proteins

  • Solubilization optimization:

    • Screen detergents (DDM, LMNG, etc.) for efficient extraction

    • Test amphipols or nanodiscs for stabilization

  • Functional verification:

    • Circular dichroism to confirm secondary structure

    • Substrate binding assays

    • Reconstitution into proteoliposomes for activity assays

How does P. gingivalis YidC contribute to antibiotic resistance mechanisms?

YidC's role in antibiotic resistance may include:

  • Membrane integrity maintenance: YidC ensures proper assembly of membrane proteins that maintain envelope integrity, potentially limiting antibiotic penetration.

  • Efflux pump assembly: YidC likely participates in the assembly of membrane efflux systems that export antibiotics from the cell.

  • PMF-dependent resistance: Given YidC's role in maintaining PMF , it may indirectly affect resistance to antibiotics that require PMF for uptake or function.

  • Stress response modulation: Similar to E. coli, P. gingivalis YidC depletion may trigger stress responses that affect antibiotic susceptibility.

What is the relationship between YidC function and gingipain maturation in P. gingivalis?

Gingipains (RgpA/B and Kgp) are critical virulence factors in P. gingivalis that undergo complex maturation:

  • Processing requirements: Gingipains require proteolytic processing for activation and stability. RgpA/B arginine gingipains mediate the proteolytic processing necessary for Mfa1 fimbriae polymerization .

  • YidC's potential role:

    • May facilitate insertion of gingipain precursors into the membrane

    • Could assist in the assembly of processing machinery

    • Might influence the proper localization of mature gingipains

  • Stabilization strategies: Cysteine residues in gingipains (C471 in RgpA and C477 in Kgp) regulate protease activity. Site-directed mutagenesis to substitute these residues with alanine inhibits self-digestion while maintaining immunogenicity .

How can comparative analysis of YidC across bacterial species inform therapeutic strategies against P. gingivalis?

Comparative analysis offers insights for targeted therapy development:

  • Conservation and divergence:

    • Identify conserved functional domains as broad-spectrum targets

    • Pinpoint P. gingivalis-specific features for selective targeting

  • Structure-based drug design opportunities:

    • Evolutionary co-variation analysis can reveal critical interaction interfaces

    • Molecular dynamics simulations can identify binding pockets unique to P. gingivalis YidC

  • Interdomain interactions:

    • Analyze coupling strength matrices to identify critical residues for function

    • Target interactions specific to pathogenic species

  • Therapeutic implications table:

Comparative AspectFindingTherapeutic Application
Conserved domainsEssential for function across speciesBroad-spectrum antimicrobial targets
P. gingivalis-specific regionsUnique structural featuresSelective inhibitors with reduced impact on commensal flora
Substrate specificityDifferent from human homologsReduced host toxicity
Stress response upon inhibitionPspA-like upregulation Biomarker for therapeutic efficacy

What are the most promising approaches for studying YidC-dependent proteome in P. gingivalis?

Advanced proteomics approaches offer the greatest potential:

  • Quantitative membrane proteomics:

    • SILAC or TMT labeling to compare wild-type and YidC-depleted strains

    • Analysis of membrane fraction enrichment/depletion

    • Temporal profiling during depletion to distinguish direct vs. indirect effects

  • Proximity labeling:

    • Express YidC fused to enzymes like BioID or APEX2

    • Identify nearby proteins through biotinylation and streptavidin pull-down

    • Apply in various growth conditions to capture condition-specific interactions

  • Ribosome profiling:

    • Identify mRNAs actively translated at the membrane

    • Compare between wild-type and YidC-depleted conditions

    • Correlate with membrane proteome changes

  • In vivo crosslinking coupled with mass spectrometry:

    • Capture transient interactions between YidC and substrate proteins

    • Identify crosslinked peptides to map interaction sites

How do post-translational modifications affect YidC function in P. gingivalis?

Post-translational modifications (PTMs) likely play regulatory roles:

  • Potential PTMs:

    • Phosphorylation: May regulate activity or interactions

    • Lipidation: Could affect membrane localization

    • Glycosylation: Might influence stability or recognition

  • Investigation methods:

    • Mass spectrometry to identify modifications

    • Site-directed mutagenesis to create non-modifiable variants

    • Functional assays comparing wild-type and PTM-deficient variants

  • Environmental regulation:

    • Examine how oxidative stress, pH changes, or nutrient limitation affect YidC modifications

    • Correlate modifications with functional changes

What is the impact of YidC on P. gingivalis adaptation to host environments?

YidC likely plays crucial roles in adaptation to varying host niches:

  • Temperature adaptation:

    • YidC may be involved in membrane remodeling at different temperatures

    • Study YidC-dependent proteome at different temperatures relevant to infection sites

  • Oxidative stress response:

    • Host immune cells generate reactive oxygen species

    • YidC may facilitate assembly of detoxification systems in the membrane

  • Biofilm formation:

    • YidC's role in fimbriae assembly impacts biofilm development

    • Examine biofilm architecture in YidC-depleted strains

  • Host cell interactions:

    • YidC's influence on surface protein display affects host cell adhesion and invasion

    • Study YidC depletion effects on host-pathogen interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.