Recombinant Porphyromonas gingivalis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Mechanism

Lgt operates via a three-step lipoprotein maturation pathway:

  1. Diacylglyceryl Transfer: Lgt attaches diacylglycerol to prolipoproteins .

  2. Signal Peptide Cleavage: Lsp removes the signal peptide .

  3. N-Acylation: Lnt adds a palmitate group .

Key catalytic features:

  • Substrate Specificity: Recognizes the lipobox motif (e.g., Leu-Ala/Ser-Gly/Ala-Cys) .

  • Essentiality: Depletion of lgt in E. coli results in growth arrest, underscoring its indispensability .

  • Structural Conservation: Despite low sequence homology, Lgt homologs across bacterial phyla share conserved transmembrane helices and catalytic residues .

Role in P. gingivalis Virulence

Lgt-modified lipoproteins are pivotal for:

  • Surface Anchoring of Virulence Factors:

    • Gingipains (RgpA/Kgp): Cysteine proteases critical for immune evasion and nutrient acquisition .

    • Fimbriae (FimA): Adhesins facilitating host-cell invasion .

  • Immune Modulation: Recombinant FimA from P. gingivalis upregulates pro-inflammatory genes (e.g., CCL20, CXCL8) in oral epithelial cells, linking lipoprotein processing to periodontal inflammation .

Diagnostic Development

  • Antigen Engineering: Recombinant RgpA (modified for stability via C471A substitution) shows high specificity for detecting P. gingivalis antibodies in periodontitis patients .

  • Serum Biomarkers: IgG levels against Lgt-processed antigens correlate with systemic diseases like Alzheimer’s and diabetes .

Therapeutic Targets

  • Inhibitor Design: Small molecules targeting Lgt’s catalytic triad (e.g., His 103, Tyr 235) could disrupt lipoprotein maturation .

  • Vaccine Development: Recombinant FimA triggers robust immune responses, suggesting utility in anti-periodontitis vaccines .

Genomic Insights

  • Strain Variability: P. gingivalis strains exhibit genetic diversity in surface proteins (e.g., FimA types), influenced by horizontal gene transfer and recombination .

  • Conditional Essentiality: Genes involved in LPS and sphingolipid synthesis (regulated by lipoprotein trafficking) are critical for abscess formation .

Challenges and Future Directions

  • Stability Issues: Recombinant Lgt requires stringent storage conditions (-80°C) to retain activity .

  • Functional Redundancy: Some bacteria encode multiple Lgt paralogs, complicating targeted inhibition .

  • Host-Pathogen Dynamics: Elucidating how Lgt-modified lipoproteins interact with Toll-like receptors (TLRs) could reveal novel immunomodulatory pathways .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling specific format requirements. Please indicate your preferred format in the order notes and we will make every effort to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its inclusion in the development process.
Synonyms
lgt; PGN_0829; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Target Names
lgt
Target Protein Sequence
MTLPAFITWDFDPVLFTLFGHPIVWYGLLFALGLIILGPWIEKKMWEHEKLDSKWFESLA VYVFVGTIVGARLGHVLFYDPAYYLANPAKIFVTWEGGLASHGGTIGIIIACWLYSRRVT RKSILWVLDRLAVPTGIVAAMIRLGNLTNSEIFGRPTTLPWGFRFIRSEEYRHLVPNMDM GCHPTQIYEALCYLAVFALCMWLYWKRDAARRYSGLIVGVFLTGIFLSRFIIERIKIVQE PWELKLIESVGLNMGQLLSIPFVLAGIWLIIRAVKNPITQKLS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in P. gingivalis?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme that catalyzes the first step in lipoprotein maturation in Gram-negative bacteria. In P. gingivalis, Lgt transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine in the lipobox motif of prolipoproteins, forming a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This modification is critical for proper lipoprotein processing, which contributes to P. gingivalis virulence, including tissue invasion and immune evasion. Similar to E. coli Lgt, P. gingivalis Lgt is likely essential for bacterial growth and survival .

  • How does the lipoprotein maturation pathway work in P. gingivalis?

In P. gingivalis, lipoprotein maturation follows a three-step process similar to other Gram-negative bacteria:

a) Lgt catalyzes the transfer of a diacylglyceryl group to the conserved cysteine residue in the lipobox motif of prolipoproteins .
b) Signal peptidase II (Lsp) cleaves the signal peptide at the amino-terminal end of the diacylated cysteine, resulting in apolipoprotein formation .
c) Apolipoprotein N-acyltransferase (Lnt) adds a fatty acid (often palmitate) to the α-amino group of the cysteine residue .

After maturation, lipoproteins are transported to their final destinations via the Lol transport system. Research shows that P. gingivalis expresses major structural components of cell surface filaments (fimbrilin and 75 kDa protein) that are matured through lipoprotein precursor forms with extremely long prosequences .

  • What is known about the membrane topology and structure of bacterial Lgt proteins?

Based on studies of E. coli Lgt, these proteins typically feature multiple transmembrane domains with specific structural elements:

a) Transmembrane helices (TM): E. coli Lgt contains 6-7 TM domains that anchor the protein in the inner membrane .
b) Arm domain: Connects transmembrane segments and contributes to functional diversity .
c) Head domain: Critical for catalytic activity .

Structural determination methods include:

  • Fusion protein analysis with reporter enzymes like β-galactosidase and alkaline phosphatase

  • Substituted Cysteine Accessibility Method (SCAM) to assess residue accessibility

  • Computational prediction tools for transmembrane segment identification

  • X-ray crystallography or cryo-electron microscopy for high-resolution structures

For P. gingivalis Lgt specifically, researchers would need to conduct targeted studies to determine if its topology follows the E. coli model.

Experimental Methodology

  • What are optimal methods for expressing recombinant P. gingivalis Lgt?

Based on successful approaches with other P. gingivalis recombinant proteins, the following methodological framework is recommended:

a) Gene amplification and cloning:

  • Design primers with appropriate restriction sites (e.g., NdeI and XhoI)

  • Amplify the lgt gene from P. gingivalis genomic DNA (strains ATCC 33277 or W83 are commonly used)

  • Clone into an expression vector such as pET22b with a C-terminal His-tag

b) Expression conditions:

  • Transform into E. coli BL21(DE3) cells

  • Culture at 37°C until reaching OD600 of 0.6-0.8

  • Induce with 0.5 mM IPTG for 6 hours at 37°C

  • For membrane proteins like Lgt, lower induction temperatures (16-25°C) may improve proper folding

c) Scale-up considerations:

  • For Hgp44 from P. gingivalis, yields of approximately 3.5 mg purified protein per liter of bacterial culture were achieved using this approach

  • Based on similar proteins, membrane protein expression may benefit from specialized E. coli strains like C41(DE3) or C43(DE3)

  • How can recombinant P. gingivalis Lgt be purified for structural and functional studies?

Purification of recombinant P. gingivalis Lgt requires specialized approaches for membrane proteins:

a) Cell lysis and membrane preparation:

  • Harvest cells by centrifugation (8,000 g, 10 minutes, 4°C)

  • Resuspend in buffer containing protease inhibitors

  • Lyse cells using sonication or mechanical disruption

  • Isolate membranes by ultracentrifugation (100,000 g, 1 hour, 4°C)

b) Membrane protein solubilization:

  • Solubilize membranes using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, Triton X-100)

  • Optimize detergent concentration (typically 1-2%) and incubation time

c) Affinity chromatography:

  • For His-tagged proteins, use immobilized metal-chelating affinity chromatography (IMAC) with Ni²⁺ matrix columns

  • Include detergent in all buffers to maintain protein solubility

  • Elute with imidazole gradient (typically 50-500 mM)

d) Further purification:

  • Size exclusion chromatography to remove aggregates and impurities

  • Ion exchange chromatography if additional purity is required

e) Quality assessment:

  • SDS-PAGE to assess purity

  • Western blot with anti-His tag antibodies to confirm identity

  • Mass spectrometry for precise molecular weight determination

  • How can researchers assess the enzymatic activity of recombinant P. gingivalis Lgt?

Multiple complementary approaches can be employed to measure Lgt activity:

a) In vitro lipid transfer assays:

  • Prepare synthetic prolipoprotein substrates containing the canonical lipobox motif [L-A(S)-G(A)-C]

  • Isolate phosphatidylglycerol from bacterial membranes or use synthetic sources

  • Incubate recombinant Lgt with substrate and phosphatidylglycerol in detergent micelles

  • Analyze reaction products by mass spectrometry or SDS-PAGE to detect mobility shift

b) Radiolabeling approaches:

  • Use ³H-labeled phosphatidylglycerol as donor substrate

  • Measure transfer of radioactivity to protein substrate

  • Separate reaction products by TLC or SDS-PAGE

  • Quantify radioisotope incorporation by scintillation counting

c) Fluorescence-based assays:

  • Design fluorescent prolipoprotein substrates where diacylglyceryl modification causes spectral changes

  • Monitor fluorescence changes in real-time during reaction

  • Useful for high-throughput screening of reaction conditions or inhibitors

d) Complementation studies:

  • Test ability of P. gingivalis Lgt to complement growth of E. coli lgt depletion strains

  • Compare wild-type and mutant versions to identify critical residues

Genetic Manipulation and Functional Analysis

  • What genetic approaches can be used to modify and study P. gingivalis Lgt in its native context?

P. gingivalis genetic manipulation can be achieved through several approaches:

a) Natural transformation protocol (optimized conditions):

  • Culture P. gingivalis anaerobically at 37°C until early-mid exponential phase (OD600 ~0.3)

  • Harvest cells by centrifugation (8,000 g, 4 min)

  • Resuspend in fresh prewarmed BHI-HM medium

  • Mix 20 μL cell suspension with 100 ng donor DNA containing ~1,000-bp homology arms

  • Spot mixture on BHI-HM blood-agar plate and incubate anaerobically for 24h

  • Collect resulting colony biofilm and plate on selective media

  • Transformation efficiency reaches 7.7 × 10⁵ CFU/mL (transformation frequency ~2.0 × 10⁻⁴)

b) Gene deletion strategy:

  • Amplify 5' and 3' flanking regions of the target gene

  • Amplify antibiotic resistance marker (e.g., ermF for erythromycin or cepA for ampicillin)

  • Assemble fragments into deletion cassette by overlap extension PCR

  • Transform P. gingivalis as described above

  • Select transformants on appropriate antibiotics

  • Verify gene replacement by PCR

c) Growth phase considerations:

  • Natural competence is highest during early-exponential phase

  • Transformation efficiency drastically declines upon entering stationary phase

  • For essential genes like lgt, conditional expression systems may be necessary

  • What is known about essential residues in Lgt and their importance for function?

Studies of E. coli Lgt have identified several critical residues that may be conserved in P. gingivalis Lgt:

a) Absolutely essential residues (substitution causes complete loss of function):

  • Y26 (in transmembrane domain 1)

  • R143 (in transmembrane domain 4)

  • N146 (in transmembrane domain 4)

  • G154 (in loop between TM-4 and head domain)

  • R239 (in transmembrane domain 6)

b) Important but non-essential residues (substitution causes growth delay):

  • G98 (between arm-2 and TM-3)

  • G104 (in TM-3)

  • E151 (in loop between TM-4 and head domain)

c) Less critical residues (substitution has minimal effect):

  • D129

  • E243

d) Special case:

  • H103Q variant allows growth to mid-exponential phase but lacks full functionality

For P. gingivalis Lgt, researchers should perform:

  • Sequence alignment with E. coli Lgt to identify conserved residues

  • Site-directed mutagenesis of candidate residues

  • Complementation studies in appropriate genetic systems

  • Structural modeling to understand the spatial arrangement of these residues

  • How can researchers study the effects of P. gingivalis Lgt on lipoprotein processing and virulence factor expression?

A multifaceted approach includes:

a) Proteomics analysis:

  • Compare membrane proteome profiles between wild-type and Lgt-depleted P. gingivalis

  • Identify lipoproteins affected by Lgt depletion

  • Use techniques like 2D-gel electrophoresis, LC-MS/MS, and MALDI-TOF

b) Fimbriae and gingipain expression:

  • Monitor maturation of fimbrilin and 75 kDa protein, which are known to be processed through lipoprotein precursors

  • Analyze gingipain activity using chromogenic substrates

  • Perform immunoblotting to detect precursor accumulation when Lgt function is compromised

c) Lipoprotein pulse-chase:

  • Radioactively label P. gingivalis proteins

  • Track processing of specific lipoproteins over time

  • Compare processing between wild-type and Lgt-depleted strains

d) [³H]-palmitic acid labeling:

  • Use to detect lipidated proteins

  • Compare lipid incorporation patterns between wild-type and Lgt-modified strains

e) Phenotypic assays:

  • Biofilm formation capacity

  • Adhesion to host cells

  • Resistance to antimicrobial peptides

  • Virulence in animal models

Host-Pathogen Interactions

  • How do P. gingivalis lipoproteins influence host immune responses?

P. gingivalis lipoproteins trigger specific immune responses that can be studied through:

a) Cell stimulation experiments:

  • Expose human cells (e.g., oral squamous carcinoma cells, HUVECs) to recombinant lipoproteins

  • Measure cytokine production:

    • FimA stimulation of oral squamous carcinoma cells causes upregulation of CCL20, TNFAIP6, CXCL8, TNFAIP3, and NFkBIA

    • Hgp44 induces IL-6 and IL-8 secretion from HUVECs in a time-dependent and concentration-dependent manner

b) Transcriptomic analysis:

  • RNA sequencing to identify differentially expressed genes

  • For example, FimA stimulation for 4h shows strong immunologic transcriptomic response signature, while after 24h, genes related to cell metabolic pathways and replication are predominantly regulated

  • Enrichment analysis using GO, KEGG, and REACTOME to identify affected pathways

c) Validation studies:

  • Confirm key transcriptomic findings using quantitative real-time PCR

  • Test protein expression by ELISA or Western blotting

  • Table showing cytokine production after Hgp44 stimulation:

CytokineStimulation TimeLow Conc. (10 μg/mL)Medium Conc. (100 μg/mL)High Conc. (1000 μg/mL)
IL-62 hoursMinimalLowLow
IL-68 hoursLowModerateLow
IL-624 hoursModerateHighLow
IL-82 hoursMinimalLowLow
IL-88 hoursLowModerateLow
IL-824 hoursModerateHighLow

Data adapted from findings with Hgp44 protein

  • How might P. gingivalis Lgt be involved in interactions with other microorganisms during periodontal infection?

P. gingivalis interacts with various microorganisms in the oral cavity:

a) Virus interactions:

  • Computational docking analysis shows P. gingivalis KGP gingipain can interact with herpes simplex virus ICP4 transcription factor (binding energy -288.29 kJ mol⁻¹)

  • All studied periodontitis patients showed presence of HSV microRNA-6 in subgingival tissue samples

  • Lgt-processed lipoproteins may similarly interact with viral components

b) Methodological approaches:

  • Co-culture experiments with P. gingivalis (wild-type or Lgt-modified) and other oral bacteria/viruses

  • Biofilm formation assays with mixed microbial communities

  • Transcriptomics of polymicrobial communities

  • Molecular dynamics simulations to predict protein-protein interactions between P. gingivalis Lgt-processed proteins and components of other microorganisms

c) In vivo studies:

  • Examine microbial composition in animal models infected with wild-type versus Lgt-modified P. gingivalis

  • Use 16S rRNA sequencing to assess microbiome shifts

  • What animal models are suitable for studying P. gingivalis Lgt function in vivo?

Several animal models have been validated for P. gingivalis research:

a) Murine subcutaneous chamber model:

  • Implant titanium coil chambers subcutaneously in mice

  • Challenge with P. gingivalis (wild-type or Lgt-modified)

  • Monitor bacterial clearance, host response, and pathology

  • Chamber fluid can be sampled to assess bacterial counts, PMN infiltration, and cytokine production

  • This model has demonstrated that passive immunization with P. gingivalis-specific IgG protects against infection

b) Collagen-induced arthritis model:

  • Used to study P. gingivalis contribution to rheumatoid arthritis

  • P. gingivalis infection exacerbates collagen-induced arthritis in mice

  • Dependent on P. gingivalis peptidylarginine deiminase (PPAD)

  • Could evaluate if Lgt-processed lipoproteins contribute to this effect

c) Oral infection models:

  • Oral gavage of P. gingivalis followed by assessment of alveolar bone loss

  • Suitable for long-term studies of periodontitis progression

  • Can assess effects of Lgt modification on colonization and virulence

d) Experimental parameters to measure:

  • Bacterial burden (CFU counts)

  • Tissue destruction (histopathology)

  • Inflammatory markers (cytokine levels)

  • Antibody responses

  • Systemic spread of bacteria

Advanced Research Applications

  • What is the potential of P. gingivalis Lgt as a target for vaccine development?

Lgt presents several characteristics that make it a potential vaccine target:

a) Essentiality: As demonstrated in E. coli, Lgt is likely essential for P. gingivalis viability , making it an attractive target since inhibition would be lethal to the pathogen

b) Surface accessibility: While Lgt itself is membrane-embedded, Lgt-processed lipoproteins are surface-exposed and recognized by the immune system

c) Conservation: Lgt function is conserved across Gram-negative bacteria, but sequence variations exist that could be exploited for specific targeting

d) Precedent from other P. gingivalis antigens:

  • Recombinant adhesins from RgpA-Kgp proteinase-adhesin complex (particularly rKgp(A1) and rKgp(A1)(759-989)) have shown protection in murine models

  • The predominant antibody isotype produced was IgG1

  • The N-terminus of recombinant RgpA demonstrated excellent ability to differentiate between diseased and non-diseased states (sensitivity 0.85, specificity 0.9, AUC 0.915)

e) Vaccine development strategy:

  • Identify immunogenic epitopes from Lgt or Lgt-processed lipoproteins

  • Produce recombinant antigens using the wheat germ cell-free translation system

  • Test immunogenicity and protective efficacy in animal models

  • Evaluate cross-protection against different P. gingivalis strains

  • How can structural biology approaches enhance our understanding of P. gingivalis Lgt?

Structural biology provides critical insights into Lgt function:

a) Comparative structural analysis:

  • Compare P. gingivalis Lgt to structures from other bacteria, such as the LolA and LolB proteins recently studied from P. gingivalis and Vibrio cholerae

  • Despite large sequence differences, structural conservation often exists in functionally important proteins

b) Key structural techniques:

  • X-ray crystallography: Requires purification of properly folded Lgt in detergent or lipid nanodisc systems

  • Cryo-electron microscopy: Potentially allows visualization of Lgt in a more native membrane environment

  • Nuclear magnetic resonance (NMR): Useful for studying dynamic regions and ligand interactions

  • Molecular dynamics simulations: Can model protein behavior and predict effects of mutations

c) Structure-function insights:

  • Identify catalytic residues and substrate binding sites

  • Map conserved vs. variable regions

  • Determine basis for substrate specificity

  • Design structure-based inhibitors

d) Protein engineering approaches:

  • Similar to the approach with RgpA and Kgp, modify critical residues (e.g., active site cysteines) to create stable, non-toxic versions for structural studies

  • Create chimeric proteins to investigate domain-specific functions

  • What bioinformatic approaches can facilitate P. gingivalis Lgt research?

Comprehensive bioinformatic analysis enhances experimental strategies:

a) Sequence analysis:

  • Multiple sequence alignment of Lgt proteins across bacterial species

  • Phylogenetic analysis to understand evolutionary relationships

  • Identification of conserved motifs and potential functional regions

b) Structure prediction:

  • Homology modeling based on known Lgt structures

  • Ab initio modeling for unique regions

  • Transmembrane topology prediction using specialized algorithms

c) Lipoprotein prediction:

  • Identify P. gingivalis lipoproteins using prediction tools (LipoP, PRED-LIPO)

  • Analyze lipobox motifs for P. gingivalis-specific patterns

  • Predict subcellular localization of lipoproteins

d) Interactome analysis:

  • Predict protein-protein interactions involving Lgt

  • Model interaction networks between Lgt and other lipoprotein processing enzymes

  • Identify potential regulatory proteins

e) Comparative genomics:

  • Compare lgt genes across P. gingivalis strains and clinical isolates

  • Analyze genomic context of lgt to identify potentially co-regulated genes

  • Study horizontal gene transfer patterns of lipoprotein processing machinery

  • How might P. gingivalis Lgt be involved in systemic disease connections?

P. gingivalis has been linked to multiple systemic conditions, with potential Lgt involvement:

a) Cardiovascular disease:

  • P. gingivalis LPS circulates systemically in >50% of periodontal patients

  • Triggers matrix metalloproteinase production and cardiac dysfunction

  • Lgt-processed lipoproteins may similarly enter circulation and affect distant tissues

b) Rheumatoid arthritis:

  • P. gingivalis infection exacerbates collagen-induced arthritis through peptidylarginine deiminase (PPAD)

  • Lgt-processed lipoproteins could contribute to systemic inflammation and autoimmune reactions

c) Alzheimer's disease:

  • P. gingivalis has been associated with Alzheimer's disease

  • Research could investigate if specific Lgt-processed lipoproteins contribute to neuroinflammation

d) Diabetes mellitus:

  • P. gingivalis is associated with diabetes mellitus

  • Lgt-dependent mechanisms might influence systemic metabolism and insulin resistance

e) Research approaches:

  • Serum antibody testing against specific Lgt-processed lipoproteins in patients with systemic diseases

  • Animal models of systemic diseases with P. gingivalis infection (wild-type vs. Lgt-modified)

  • Transcriptomic and proteomic studies of non-oral tissues following P. gingivalis infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.