Recombinant Porthidium nasuta NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Introduction to Porthidium nasuta and MT-ND4

Porthidium nasutum, commonly known as the Hognosed pitviper or Bothrops nasutus, is a venomous snake species notable for its complex venom composition and distinctive mitochondrial genome characteristics . NADH-ubiquinone oxidoreductase chain 4 (MT-ND4) is a critical component of the mitochondrial respiratory chain, specifically of Complex I, which is responsible for the first step of electron transport in cellular respiration. The "MT" prefix in MT-ND4 designates its mitochondrial origin, reflecting its encoding in the mitochondrial genome rather than nuclear DNA.

Snake mitochondrial genomes have attracted considerable scientific interest due to their unique evolutionary characteristics, including gene duplications, rearrangements, and accelerated evolutionary rates compared to other vertebrates . These genomes have played a significant role in resolving phylogenetic relationships among snake lineages, particularly regarding early divergences within alethinophidian snakes. Recent studies have identified dramatic gene-specific and branch-specific relative acceleration in snake protein-coding gene evolution, especially along internal branches leading to Serpentes and Alethinophidia .

Expression and Purification Methods

Commercial preparations of recombinant P. nasuta MT-ND4 are typically expressed in E. coli expression systems with N-terminal His-tags to facilitate purification . This approach allows for efficient isolation of the protein using affinity chromatography. According to product specifications, the purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis .

The recombinant protein is generally provided in lyophilized powder form, which enhances stability during shipping and storage. For reconstitution, manufacturers recommend using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL . To maintain stability after reconstitution, the addition of glycerol (typically 5-50% final concentration) is recommended for long-term storage at -20°C or -80°C .

Storage considerations are important for maintaining the functionality of the recombinant protein. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . The typical storage buffer consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0, which has been optimized to maintain protein stability .

Biological Function and Evolutionary Significance

MT-ND4 functions as a subunit of NADH dehydrogenase (Complex I) in the mitochondrial respiratory chain, playing a crucial role in electron transport and cellular energy production. This enzyme complex catalyzes the transfer of electrons from NADH to ubiquinone (Coenzyme Q), contributing to the proton gradient that drives ATP synthesis.

In the context of snake evolution, mitochondrial genes like MT-ND4 have undergone interesting structural changes. Comparative analyses across snake species have revealed variations in the length of the ND4 gene: colubroid snakes typically have ND4 sequences of 1338 nucleotides (with the exception of Achalinus meiguensis at 1353 sites), while Acrochordus granulatus and henophidian snakes possess longer sequences at 1356 nucleotides . These length differences are attributed to a single gap approximately 130-150 nucleotides into the sequence .

Such variations in gene structure have contributed to the utility of mitochondrial genes in resolving phylogenetic relationships among snake lineages. The accelerated evolutionary rate of snake mitochondrial genes compared to other vertebrates makes them valuable markers for evolutionary studies .

Research Applications

While specific research applications of recombinant P. nasuta MT-ND4 are not extensively documented in the provided search results, several potential uses can be inferred based on related research in comparative mitochondrial biology and snake evolution.

The availability of purified recombinant MT-ND4 enables various biochemical and structural studies, including:

  1. Comparative analysis of snake mitochondrial protein structure and function

  2. Investigation of the evolutionary patterns in respiratory chain components across reptile species

  3. Development of antibodies for immunological studies of snake mitochondrial proteins

  4. Structure-function relationship studies of Complex I components

Additionally, MT-ND4 can serve as a valuable tool in phylogenetic analyses, contributing to our understanding of snake evolution and diversification. The recombinant protein's availability allows for direct biochemical characterization that can complement genomic and transcriptomic approaches to studying mitochondrial function in snakes.

Comparative Analysis with Other Snake Species

The structure and sequence of MT-ND4 vary across snake species, reflecting their evolutionary history and adaptations. These variations make MT-ND4 a useful marker for phylogenetic studies. Notable differences have been observed in the length of the ND4 gene among major snake lineages, as summarized in Table 2.

Table 2: Comparison of ND4 Gene Length Across Snake Lineages

Snake LineageND4 Gene Length (nucleotides)Notable FeaturesReference
Colubroid snakes (general)1338Standard length for this lineage
Achalinus meiguensis1353Exception within colubroids
Acrochordus granulatus1356Longer variant
Henophidian snakes1356Same length as Acrochordus

These differences are attributed to specific gaps in the sequence, particularly one occurring approximately 130-150 nucleotides into the sequence . Such structural variations contribute to our understanding of the evolutionary history of snakes and can provide insights into the functional adaptations of their mitochondrial proteins.

Future Research Directions

While our understanding of P. nasuta MT-ND4 has advanced, several areas warrant further investigation:

  1. Detailed structural characterization through crystallography or cryo-electron microscopy

  2. Comparative functional studies with MT-ND4 from other snake species

  3. Investigation of potential interactions between MT-ND4 and other components of the respiratory chain

  4. Exploration of the evolutionary pressures that have shaped the sequence and structure of snake MT-ND4

Such studies would contribute to our broader understanding of mitochondrial evolution in snakes and potentially reveal unique adaptations in energy metabolism that correlate with their ecological and physiological characteristics.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Porthidium nasutum (Hognosed pitviper) (Bothrops nasutus)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQILPMTKTDVFLPFIILALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIMIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTSTWWLLANLMNMATPPTLNFTSELLIMSTLFNWCPTTIILLGLSMLIT ASYSLHMFLSTQMGPTLLNNQTEPTHSREHLLMALHLVPLMMISMKPELII
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly required for enzymatic activity. Complex I functions in transferring electrons from NADH to the respiratory chain. The enzyme's immediate electron acceptor is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.