Recombinant Porthidium ophryomegas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format when placing your order, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributor.
Note: All of our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing it according to your specifications.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Porthidium ophryomegas (Slender hognose viper)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQILPTTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSVSHMGLVAAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTSTWWLLANLMNIATPPSLNFTSELLIMSTLFNWCPTTIILLGLSMLIT ASYSLHMFLSTQMGSTLLNSQTEPMHSREHLLMTLHLIPLMMISMKPELVI
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), thought to be part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4 and what is its role in mitochondrial function?

MT-ND4 (mitochondrially encoded NADH dehydrogenase 4) is a protein-coding gene that provides instructions for making NADH dehydrogenase 4, a critical component of the mitochondrial respiratory chain Complex I. This protein is embedded in the inner mitochondrial membrane and participates in the first step of the electron transport process. Specifically, MT-ND4 contributes to the transfer of electrons from NADH to ubiquinone during oxidative phosphorylation, which is essential for ATP production . The MT-ND4 protein functions within a large enzyme complex known as NADH:ubiquinone oxidoreductase (Complex I), which creates an unequal electrical charge across the inner mitochondrial membrane through electron transfer, thereby providing energy for ATP synthesis . In species like Porthidium ophryomegas, MT-ND4 maintains these core functions while potentially exhibiting species-specific adaptations.

How does Complex I structure relate to its function in mitochondrial energy production?

Complex I is one of several enzyme complexes necessary for oxidative phosphorylation, containing multiple iron-sulfur clusters that facilitate electron transfer. These clusters possess characteristic midpoint redox potentials and g-values that determine their electron-accepting properties . In the intact respiratory chain, electrons from NADH are transferred through these iron-sulfur clusters to ubiquinone, initiating the electron transport chain. During this process, Complex I creates an electrochemical proton gradient across the inner mitochondrial membrane that drives ATP synthesis . The structure-function relationship is highlighted by the arrangement of electron carriers in an energy-favorable sequence, with electrons moving from carriers with more negative reduction potentials to those with more positive potentials. This precise structural organization is critical for the directional flow of electrons and the coupling of this process to proton translocation.

What known structural features distinguish snake MT-ND4 from mammalian homologs?

While the search results don't specifically address Porthidium ophryomegas MT-ND4 structure, comparative studies of mitochondrial proteins across species reveal conservation of core functional domains with species-specific variations. MT-ND4 typically contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane. These membrane-spanning regions, along with connecting loops, may exhibit sequence variations between snake and mammalian homologs while maintaining the protein's core function. Researchers examining snake MT-ND4 should focus on identifying amino acid substitutions that might confer adaptive advantages related to metabolic demands, thermal regulation, or other physiological requirements specific to venomous snakes. Methodologically, sequence alignment tools combined with structural prediction algorithms can identify these distinguishing features, which may then be validated through experimental approaches such as site-directed mutagenesis.

What expression systems are most effective for producing functional recombinant MT-ND4?

The production of functional recombinant MT-ND4 requires careful consideration of expression systems that can accommodate membrane proteins with multiple transmembrane domains. While the search results don't specifically address expression systems for snake MT-ND4, researchers typically employ prokaryotic systems like E. coli with specialized strains designed for membrane protein expression, or eukaryotic systems such as yeast, insect cells, or mammalian cells that provide more native-like membrane environments. For MT-ND4 from Porthidium ophryomegas, researchers should consider:

  • Codon optimization for the selected expression host

  • Addition of fusion tags that facilitate membrane insertion and purification

  • Induction conditions that balance protein expression with proper membrane integration

  • Detergent screening for optimal solubilization of the expressed protein

When establishing an expression system, it's crucial to verify that the recombinant protein retains its electron transfer capabilities through activity assays that measure NADH oxidation coupled to artificial electron acceptors such as ferricyanide.

What are the most reliable methods for measuring the activity of recombinant MT-ND4 in experimental settings?

Measuring the activity of recombinant MT-ND4 requires assays that can detect electron transfer from NADH to appropriate acceptors. Based on established methods for Complex I, several approaches are recommended:

  • NADH oxidation assays: Monitoring the decrease in NADH absorbance at 340 nm during reaction with artificial electron acceptors such as ferricyanide or ruthenium compounds. These assays have demonstrated high sensitivity, with rates of up to 180,000 nmol min⁻¹mg⁻¹ for ferricyanide and 46,000 nmol min⁻¹mg⁻¹ for ruthenium complexes .

  • Ubiquinone reduction assays: Measuring the reduction of decylubiquinone or other quinone analogs in the presence of NADH. The typical rate for isolated Complex I is approximately 4.2 μmol e⁻ min⁻¹mg⁻¹ .

  • Superoxide production assays: Using acetylated cytochrome c reduction to monitor superoxide generation, which can indicate functional electron transfer through MT-ND4 and Complex I. Under standard conditions, Complex I generates approximately 40 nmol O₂⁻ min⁻¹mg⁻¹ in air-saturated solutions .

These assays should be performed with appropriate controls, including specific inhibitors like rotenone, piericidin A, or capsaicin to confirm Complex I-specific activity.

How can researchers effectively analyze the interaction between recombinant MT-ND4 and other Complex I subunits?

Analyzing interactions between recombinant MT-ND4 and other Complex I subunits requires techniques that can detect protein-protein associations within membrane environments. Effective methodological approaches include:

  • Co-immunoprecipitation with antibodies specific to MT-ND4 or other Complex I subunits

  • Blue native PAGE to isolate intact protein complexes containing MT-ND4

  • Cross-linking mass spectrometry to identify specific contact points between MT-ND4 and neighboring subunits

  • Reconstitution experiments where recombinant MT-ND4 is incorporated into Complex I subcomplexes or depleted membranes

When studying Porthidium ophryomegas MT-ND4, researchers should design experiments that can distinguish between conserved interactions essential for Complex I assembly and species-specific interactions that might reflect evolutionary adaptations. Additionally, electron paramagnetic resonance (EPR) spectroscopy can be employed to examine how MT-ND4 influences the properties of iron-sulfur clusters within Complex I, as these clusters exhibit characteristic g-values and reduction potentials that can be affected by surrounding protein environment .

What is the mechanism of superoxide production by NADH:ubiquinone oxidoreductase and how is it regulated?

Superoxide production by NADH:ubiquinone oxidoreductase (Complex I) occurs through a well-defined mechanism. Based on kinetic and molecular studies, superoxide is formed predominantly by the transfer of a single electron from fully reduced flavin to molecular oxygen (O₂) . The process follows these steps:

  • NADH binds to Complex I and reduces the flavin cofactor completely.

  • When the active site is empty (no NADH or NAD⁺ bound), molecular oxygen can access the reduced flavin.

  • A single electron transfers from reduced flavin to O₂, forming superoxide (O₂⁻).

  • The resulting flavin radical is unstable, so the remaining electron likely redistributes to iron-sulfur centers within the complex.

The rate of superoxide production is determined by a bimolecular reaction between O₂ and reduced flavin in an empty active site. This rate can be expressed as:

Rate=k[O2][ComplexIreduced]Rate = k[O₂][Complex I_{reduced}]

Where the proportion of reduced Complex I competent for reaction is governed by a preequilibrium determined by:

  • Dissociation constants of NADH and NAD⁺

  • Reduction potentials of flavin and NAD⁺

Critical regulatory factors include:

  • NADH/NAD⁺ ratio: Higher ratios increase superoxide production

  • Oxygen concentration: Direct proportionality with production rate

  • NAD⁺ concentration: Strong inhibitory effect, with 30 μM NAD⁺ decreasing superoxide formation by approximately 50%

Experimental data shows that under standard conditions, approximately 1% of electrons are diverted from decylubiquinone to O₂, though this percentage varies with NADH and O₂ concentrations .

How do iron-sulfur clusters in Complex I contribute to electron transport, and what methods best characterize them?

Iron-sulfur clusters in Complex I play crucial roles in electron transport by serving as sequential electron carriers. These clusters can be characterized by their distinctive spectroscopic properties and redox potentials:

Key Iron-Sulfur Clusters and Properties:

ClusterTypeMidpoint Potential (Em8.0)g-values (gx,y,z)Role
[N-1H]TBinuclear-274 mV1.93, 1.94, 2.02Early electron acceptor
[N-2H]TTetranuclear-304 mV1.89, 1.95, 2.04Intermediate electron carrier
[N-3]TTetranuclear-289 mV1.80, 1.83, 2.06Electron carrier
[N-1L]TBinuclear-418 mV1.93, 19.5, 2.02Very low potential carrier
[N-2L]TTetranuclear-437 mV1.89, 1.95, 2.04Very low potential carrier

These clusters form an electron transfer chain with specific redox properties that facilitate directional electron movement through the complex . The most effective methods for characterizing these clusters include:

  • Electron Paramagnetic Resonance (EPR) spectroscopy: Identifies each cluster type through characteristic g-values and enables quantification.

  • Potentiometric titrations: Determines midpoint potentials for individual clusters.

  • Site-directed mutagenesis: Identifies amino acids involved in cluster coordination.

  • Inhibitor studies: Using piericidin A and other inhibitors helps distinguish cluster functions.

When studying recombinant Porthidium ophryomegas MT-ND4, researchers should examine how this specific protein influences the properties of associated iron-sulfur clusters, potentially through perturbations in the protein environment surrounding these redox centers.

What experimental approaches can distinguish between different modes of electron transfer in recombinant MT-ND4?

To distinguish between different modes of electron transfer in recombinant MT-ND4, researchers can employ several complementary experimental approaches:

  • Inhibitor profiling: Using different classes of Complex I inhibitors (rotenone, piericidin A, capsaicin) that target distinct sites within the electron transfer pathway to identify where electron transfer through MT-ND4 occurs . This approach can help determine if recombinant MT-ND4 maintains native electron transfer routes.

  • Substrate dependence analysis: Measuring activity with varying concentrations of NADH (K₍ₘ₎ ≈ 0.05 μM for superoxide production) to establish kinetic parameters that reflect electron transfer pathways .

  • Product formation studies: Quantifying the relative ratios of different electron acceptor reduction (ubiquinone vs. oxygen) under controlled conditions. Under standard conditions, approximately 1% of electrons from NADH are diverted to oxygen rather than ubiquinone .

  • Redox titration combined with spectroscopy: Monitoring the reduction state of specific electron carriers (flavin and iron-sulfur clusters) during controlled redox titrations to map electron flow pathways.

  • Temperature-dependent kinetics: Analyzing activation energies for different electron transfer reactions to distinguish thermodynamic parameters associated with alternative electron transfer routes.

These approaches can help researchers determine whether recombinant Porthidium ophryomegas MT-ND4 preserves the electron transfer characteristics of native Complex I or exhibits alterations that reflect species-specific adaptations or experimental artifacts.

How do variations in MT-ND4 across species correlate with metabolic adaptations?

Species-specific variations in MT-ND4 often correlate with metabolic adaptations that reflect different energetic demands and environmental pressures. When analyzing Porthidium ophryomegas MT-ND4 in comparison to other species, researchers should consider:

  • Amino acid substitutions in proton-pumping domains: Changes that may affect the efficiency of proton translocation and therefore the energy conservation capacity of Complex I.

  • Modifications near iron-sulfur binding regions: Substitutions that could alter the redox properties of associated electron carriers, potentially affecting electron transfer rates or coupling efficiency.

  • Thermal stability adaptations: Variations that might enhance protein stability at different body temperatures, particularly relevant when comparing ectothermic snakes with endothermic mammals.

  • Substrate binding region modifications: Changes that might alter NADH binding affinity (K₍ₘ₎), which could be correlated with different metabolic rates across species.

To properly assess these correlations, researchers should employ comprehensive phylogenetic analyses combined with structural modeling and functional assays that can quantify specific parameters like NADH oxidation rates, proton pumping efficiency, and thermal stability. These comparative studies can provide insights into how MT-ND4 has evolved to support different metabolic strategies across vertebrate lineages.

What can the study of Porthidium ophryomegas MT-ND4 reveal about mitochondrial adaptation in venomous snakes?

The study of Porthidium ophryomegas MT-ND4 may reveal important insights into mitochondrial adaptations specific to venomous snakes. Key research directions should include:

  • Energy demands of venom production: Investigating whether MT-ND4 modifications support the high energetic requirements of venom gland tissue, which requires substantial ATP for protein synthesis and secretion.

  • Thermal adaptation mechanisms: Examining how MT-ND4 structure supports mitochondrial function across the temperature range experienced by these ectothermic animals, potentially through altered electron transfer efficiency at different temperatures.

  • Oxidative stress management: Determining if MT-ND4 from venomous snakes exhibits adaptations that modulate superoxide production, which could be particularly important in tissues with high metabolic activity like venom glands.

Methodologically, researchers should compare recombinant Porthidium ophryomegas MT-ND4 activity across a range of experimental conditions that mimic physiologically relevant parameters for this species, including temperature ranges, pH values, and substrate concentrations that reflect the snake's natural environment and physiological state during different activities (resting, digestion, venom production).

How can researchers effectively use MT-ND4 sequence data for phylogenetic studies of snake species?

MT-ND4 has proven valuable for phylogenetic studies of snake species due to its appropriate rate of molecular evolution. To effectively use MT-ND4 sequence data for such studies, researchers should:

  • Employ comprehensive sampling strategies: Include multiple individuals per species and representatives from diverse lineages to ensure robust phylogenetic inference.

  • Use appropriate molecular evolutionary models: Select models that account for the specific patterns of nucleotide substitution observed in snake MT-ND4, including codon position effects and potential selection pressures.

  • Combine with nuclear markers: Integrate MT-ND4 data with nuclear genes to address potential discordance between mitochondrial and nuclear evolutionary histories.

  • Account for selection pressures: Consider that functional constraints on MT-ND4 may vary across lineages depending on metabolic requirements, potentially affecting substitution rates.

  • Implement dating analyses: Use calibration points from the fossil record to estimate divergence times and rates of MT-ND4 evolution across snake lineages.

These approaches can help researchers develop well-supported phylogenetic hypotheses while also providing insights into how functional constraints on MT-ND4 may have influenced its evolutionary trajectory in different snake lineages, including venomous species like Porthidium ophryomegas.

What insights from MT-ND4 studies inform our understanding of mitochondrial diseases?

Studies of MT-ND4 have significantly contributed to our understanding of mitochondrial diseases, particularly Leber hereditary optic neuropathy (LHON). The G11778A (Arg340His) variant in MT-ND4 is the most common cause of LHON, responsible for approximately 70% of cases worldwide . This mutation replaces the amino acid arginine with histidine, affecting a functionally critical region of the protein. Research on MT-ND4 mutations has revealed several important insights:

  • Structure-function relationships: MT-ND4 mutations disrupt Complex I activity, reducing ATP synthesis capacity and increasing reactive oxygen species production.

  • Tissue specificity: Despite MT-ND4 being expressed in all tissues with mitochondria, certain mutations predominantly affect retinal ganglion cells, suggesting tissue-specific vulnerability factors.

  • Threshold effects: The proportion of mutant to wild-type MT-ND4 (heteroplasmy) influences disease manifestation, with symptoms typically appearing when mutation load exceeds a critical threshold.

  • Nuclear-mitochondrial interactions: Nuclear genetic background can modify the expression of MT-ND4 mutations, explaining variable penetrance observed in families with identical mitochondrial mutations.

Researchers working with recombinant Porthidium ophryomegas MT-ND4 can design comparative studies to determine how structural differences between snake and human MT-ND4 might influence the functional consequences of equivalent mutations, potentially providing new insights into the pathogenic mechanisms of human MT-ND4 mutations.

How can recombinant MT-ND4 be used to study oxidative stress mechanisms?

Recombinant MT-ND4 provides a valuable tool for studying oxidative stress mechanisms, particularly those involving mitochondrial superoxide production. Experimental approaches should include:

  • Reconstitution studies: Incorporating recombinant MT-ND4 into membrane systems to measure how it influences superoxide production rates. Under controlled conditions, Complex I generates approximately 40 nmol O₂⁻ min⁻¹mg⁻¹, with about 1% of electrons diverted from the normal pathway to oxygen .

  • Mutational analysis: Introducing specific amino acid substitutions to recombinant MT-ND4 to identify residues that modulate superoxide production, focusing on regions involved in NADH binding, flavin interaction, or ubiquinone reduction.

  • Inhibitor sensitivity profiling: Comparing how different Complex I inhibitors (rotenone, piericidin A, capsaicin) affect superoxide production by systems containing recombinant MT-ND4, which can reveal details about the electron transfer mechanism .

  • NADH/NAD⁺ ratio effects: Systematically varying NADH and NAD⁺ concentrations to establish how nucleotide binding affects superoxide generation. This approach is particularly informative as NAD⁺ strongly inhibits superoxide production (30 μM NAD⁺ decreases production by approximately 50%) .

These studies can help elucidate the molecular determinants of mitochondrial reactive oxygen species production and potentially identify strategies for modulating oxidative stress in disease contexts.

What approaches can determine the effect of MT-ND4 variants on Complex I assembly and stability?

Determining how MT-ND4 variants affect Complex I assembly and stability requires multiple complementary approaches:

  • Blue native PAGE: Allows visualization of intact Complex I and assembly intermediates containing MT-ND4 variants, enabling quantification of fully assembled complex versus subcomplexes.

  • Pulse-chase experiments: Can track the incorporation of newly synthesized MT-ND4 variants into Complex I and measure the half-life of the assembled complex, revealing effects on both assembly kinetics and stability.

  • Protease sensitivity assays: Differential susceptibility to controlled proteolysis can indicate structural perturbations caused by MT-ND4 variants that might affect complex stability.

  • Thermal stability profiling: Measuring activity retention after controlled heat exposure can reveal how MT-ND4 variants influence the thermodynamic stability of Complex I.

  • Crosslinking mass spectrometry: Can identify altered interaction patterns between MT-ND4 variants and neighboring subunits, providing molecular details about assembly defects.

For Porthidium ophryomegas MT-ND4, researchers should design experiments that can distinguish between naturally occurring sequence variations that support normal complex assembly in this species versus experimental mutations that might disrupt assembly. This comparative approach can provide insights into the structural elements of MT-ND4 that are critical for Complex I assembly across species versus those that may have undergone species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.