Recombinant Potassium-transporting ATPase A chain 2 (kdpA2)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant kdpA2 is a synthetic version of the native KdpA subunit from the KdpFABC complex, a multi-subunit ATPase responsible for K⁺ uptake in bacteria like Staphylococcus aureus . Key production details include:

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His tag for purification
Amino Acid Sequence307 residues (e.g., ALSMMLIPGSLVFLFGRMLKTKLQIHPHAIMIFVAMFVMFIGFLVTCLYFEF...)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

This recombinant protein retains functional properties of the native KdpA subunit, including ion selectivity and ATPase coupling .

Key Mutational Insights:

MutationEffect on Function
G232A/SLoss of K⁺ selectivity; permits Na⁺ transport
G233DReduced K⁺ affinity (Km increases from 0.2 mM to >10 mM)
G234VMinimal impact on selectivity, highlighting G232’s dominance in ion recognition

Functional Role in the KdpFABC Complex

KdpA2 operates within the KdpFABC complex, which couples ATP hydrolysis to K⁺ transport:

  1. K⁺ Binding: K⁺ enters KdpA’s SF, displacing water molecules to initiate transport .

  2. Tunnel Transfer: K⁺ traverses an intramembrane tunnel to KdpB’s B1 site, a high-affinity binding pocket .

  3. ATP-Driven Release: Conformational changes in KdpB (E1→E2-P transition) lower affinity, releasing K⁺ into the cytoplasm .

Kinetic Properties:

  • K⁺ Stimulation: ATPase activity increases 10-fold with 1 mM K⁺ .

  • NH₄⁺ Compatibility: ATPase activity is also stimulated by NH₄⁺, albeit with lower specificity .

Research Applications

Recombinant kdpA2 is pivotal for:

  • Mechanistic Studies: Cryo-EM structures (e.g., PDB 6XYZ) resolve K⁺ pathways and conformational states .

  • Drug Discovery: Targeting KdpA’s SF could disrupt bacterial ion homeostasis, offering antibiotic potential .

  • Evolutionary Analysis: Comparing KdpA with K⁺ channels (e.g., KcsA) reveals shared selectivity mechanisms .

Comparative Analysis of Recombinant Variants

SourceSpeciesTagLengthApplications
Creative BioMart Staphylococcus aureusHis1–307ATPase assays, structural biology
Creative Biolabs Staphylococcus aureusNone1–307Vaccine development, pathogenicity studies
Cusabio Escherichia coliVariablePartialBiochemical characterization

Future Directions

  • Dynamic Simulations: Molecular dynamics could clarify how K⁺ translocates through the static KdpA tunnel .

  • Pathogen Targeting: S. aureus kdpA2 is a potential therapeutic target due to its role in osmoregulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
kdpA; kdpA2; Potassium-transporting ATPase potassium-binding subunit; ATP phosphohydrolase [potassium-transporting] A chain; Potassium-binding and translocating subunit A; Potassium-translocating ATPase A chain; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
kdpA
Target Protein Sequence
ALSMMLIPGSLVFLFGRMLKTKLQIHPHAIMIFVAMFVMFIGFLVTCLYFEFAGNPVLHH LGIAGGNMEGKETRFGIGLSALFTTITTAFTTGTVNNMHDSLTPLGGMVPMVLMMLNAVF GGEGVGLMNMLIYVMLTVFICSLMIGKTPSYLGMKIEGKEMKLIALSFLVHPLLILVFSA LAFIVPGASDALTNPQFHGVSQVLYEFTSSSANNGSGFEGLGDNTVFWNISTGIVMLLAR YIPIVLQILIVSSLVNKKTYQQHTQDVPINNLFFSSVLIIFIILLSGLTFLPDLMLGPIG EQLLLHA
Uniprot No.

Target Background

Function
This protein, Recombinant Potassium-transporting ATPase A chain 2 (kdpA2), is a component of the high-affinity ATP-driven potassium transport (or Kdp) system. It catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. Specifically, this subunit binds and transports potassium across the cytoplasmic membrane.
Protein Families
KdpA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Potassium-transporting ATPase A chain 2 (kdpA2)?

Recombinant kdpA2 is a transmembrane protein that forms part of the Kdp-ATPase complex, specifically from the kdp2 operon found in certain bacteria like cyanobacteria. It functions as an ATP-dependent high-affinity potassium (K+) transport system that becomes active under low potassium conditions. The kdpA2 protein is part of a polycistronic operon that includes kdpA2, kdpB2, kdpG2, and kdpC2 genes, which together encode the functional Kdp-ATPase complex . Unlike the general Na+/K+-ATPase found in animal cells, bacterial Kdp systems are specialized for high-affinity potassium uptake in potassium-limited environments and play crucial roles in bacterial adaptation to stress conditions.

How does the kdp2 operon structure differ from other potassium transport systems?

The kdp2 operon in organisms like Anabaena L-31 exhibits several unique structural features compared to other bacterial potassium transport systems:

Featurekdp2 OperonOther Bacterial Kdp Systems (e.g., E. coli)
Gene compositionkdpA2, kdpB2, kdpG2, kdpC2kdpA, kdpB, kdpC, kdpD, kdpE, kdpF
Regulatory genesLacks kdpD/kdpE two-component systemContains complete kdpD/kdpE regulatory system
Additional genesContains kdpG between kdpB2 and kdpC2Contains kdpF, lacks kdpG
Transcript size5.3-kb transcriptVaries by species
Stress responseInduced by K+ limitation and desiccationPrimarily induced by K+ limitation and osmotic stress

The kdp2 operon contains a unique hydrophobic protein encoded by kdpG2 positioned between kdpB2 and kdpC2, while lacking the kdpF gene that is present in many other bacterial Kdp systems . Furthermore, the regulatory mechanism differs significantly, as many kdp2 operons lack the complete two-component KdpD/KdpE regulatory system found in enterobacteria.

Under what conditions is kdpA2 expression induced?

The expression of kdpA2 is primarily regulated by environmental potassium levels, though additional stress factors can influence expression in certain organisms:

ConditionEffect on kdpA2 ExpressionTimeframeOrganism
K+ limitation (<50 μM)Strong inductionDetectable after 1h, maximal at 3hAnabaena L-31
K+ readdition (5 mM)Rapid repressionExpression ceases within 30 minAnabaena L-31
Desiccation stressStrong inductionVariableAnabaena L-31
Salt stressNo inductionN/AAnabaena L-31 (unlike E. coli)
pH changesNo effectN/AAnabaena L-31
Heat stressNo effectN/AAnabaena L-31
Nitrogen availabilityNo effectN/AAnabaena L-31

In Anabaena L-31, kdpA2 expression is strongly induced when potassium concentrations fall below 50 μM, with expression detected as a 5.3-kb transcript. Maximal expression occurs around 3 hours after potassium deprivation. When 5 mM potassium is reintroduced to the potassium-starved cells, kdpA2 expression ceases within 30 minutes . Interestingly, unlike in enterobacteria, desiccation stress also triggers kdpA2 expression in Anabaena, while common salt, pH changes, heat stress, and nitrogen availability do not affect expression.

What is the relationship between kdpA2 and bacterial survival in potassium-limited environments?

KdpA2 plays a critical role in bacterial adaptation and survival in potassium-limited environments through several mechanisms:

These functions collectively enable bacteria to survive in challenging environments where potassium is scarce, providing an evolutionary advantage in diverse ecological niches.

How does kdpA2 contribute to membrane potential and ATP homeostasis?

The relationship between kdpA2, membrane potential, and ATP homeostasis represents a sophisticated regulatory mechanism:

ParameterEffect of kdpA2 InactivationMechanismDownstream Effects
Membrane potential (ΔΨ)HyperpolarizationAltered K+ ion gradientIncreased proton motive force (PMF)
Proton motive forceIncreasedEnhanced cross-membrane electrochemical gradientMore substrate for ATP synthase
ATP levelsElevated (1.67-fold increase at 7 mM K+)Increased PMF driving ATP synthase activityAltered persister cell formation
CCCP toleranceIncreased (3-fold higher MIC)Modified proton gradient regulationResistance to membrane potential disruption

When kdpA is inactivated, as shown in studies with kdpA mutants, the cross-membrane potential becomes hyperpolarized. This hyperpolarization occurs because the normal influx of positively charged potassium ions is disrupted, allowing the interior of the cell to become more negatively charged . The increased membrane potential contributes to a higher proton motive force (PMF), which is the electrochemical gradient that drives ATP synthesis through the F₀F₁-ATP synthase.

Research has demonstrated that kdpA mutants exhibit a 1.67-fold increase in intracellular ATP levels compared to wild-type strains when grown in medium with standard potassium concentrations (7 mM). Interestingly, this difference disappears when the potassium concentration is raised to 140 mM, suggesting that abundant extracellular potassium can compensate for the loss of the high-affinity kdpA-mediated transport system .

The altered ATP homeostasis in kdpA mutants has significant implications for bacterial persistence. The elevated ATP levels correlate with reduced persister formation, confirming that ATP-mediated regulation of persistence is a general mechanism in bacteria. These findings suggest that kdpA2 and other potassium transporters may serve as potential targets for developing new antimicrobial strategies that either target persisters directly or reduce their formation .

What regulatory networks control kdpA2 expression under different environmental conditions?

The regulation of kdpA2 involves complex networks that differ significantly between bacterial species:

Regulatory ElementFunctionOrganism-Specific FeaturesEnvironmental Trigger
KdpD/KdpE two-component systemSensor kinase (KdpD) and response regulator (KdpE)Complete in E. coli; truncated KdpD in Anabaena L-31; no KdpE in Anabaena L-31Low K+ concentration
Promoter elementsControl transcription initiationVaries between speciesSpecies-dependent
kdpA2B2G2C2 operon structureDetermines co-transcription patterns5.3-kb transcript in Anabaena L-31K+ limitation, desiccation
Post-transcriptional regulationControls mRNA stabilityTranscript unstable in presence of K+K+ concentration
Post-translational regulationDetermines KdpB protein stabilityKdpB protein levels decrease when K+ is added backK+ concentration

In Anabaena L-31, the regulatory mechanism differs significantly from the well-characterized KdpD/KdpE two-component system found in E. coli and other enterobacteria. The Anabaena system contains only a truncated KdpD protein (365 amino acids) that shows similarity to just the N-terminal domain of E. coli KdpD, lacking the critical C-terminal histidine kinase domain responsible for phosphorylation reactions. Furthermore, no kdpE-like gene is found downstream of either kdp operon in Anabaena .

Despite these differences in regulatory proteins, kdpA2 expression in Anabaena is still tightly regulated by potassium availability. Expression is induced under low potassium conditions (<50 μM) and rapidly ceases when potassium is added back to the medium. The stability of both the kdp transcript and the Kdp-ATPase proteins (including KdpB) decreases in the presence of potassium, suggesting multiple levels of regulation .

How do mutations in kdpA2 affect bacterial physiology and stress responses?

Mutations in kdpA2 have far-reaching effects on bacterial physiology and stress responses:

Physiological ParameterEffect of kdpA2 MutationMechanismExperimental Evidence
Growth in low K+ (<0.07 mM)Significantly reducedImpaired high-affinity K+ uptakeGrowth curve analysis
pH homeostasisDisruptedAltered ion balancepH measurements
Membrane potentialHyperpolarizedChanged ionic gradientDiOC₂(3) fluorescence ratio
ATP levelsIncreased 1.67-foldEnhanced PMF driving ATP synthesisLuciferase-based ATP assay
Persister formationReduced after antibiotic exposureATP-mediated regulation of persistencePersister ratio measurements
CCCP tolerance3-fold higher MICAltered proton gradientCCCP susceptibility testing
Desiccation tolerancePotentially reducedLoss of stress-induced K+ transportExpression analysis

A particularly interesting effect of kdpA mutations is their impact on antibiotic persistence. Studies in Mycobacterium marinum have shown that kdpA mutations reduce the fraction of persisters after exposure to antibiotics like rifampicin. This reduction in persister formation is associated with increased intracellular ATP levels in the mutant strains. The phenotype can be complemented either by introducing a functional kdpA gene or by supplementing the growth medium with high potassium concentrations .

The kdpA mutants also show increased tolerance to carbonyl cyanide m-chlorophenyl hydrazone (CCCP), an H+ ionophore that disrupts the proton gradient. This tolerance is most pronounced at standard potassium concentrations (7 mM) and diminishes at higher potassium levels (70 mM or 140 mM), suggesting that the altered membrane potential in kdpA mutants provides some protection against CCCP-mediated proton flux disruption .

What are the key differences between kdpA1 and kdpA2 in organisms with multiple kdp operons?

Some organisms, such as the cyanobacterium Anabaena L-31, contain multiple kdp operons with distinct characteristics and functions:

Featurekdp1 Operonkdp2 OperonFunctional Implications
Gene compositionkdpA1, kdpB1, kdpG1, kdpC1, kdpDkdpA2, kdpB2, kdpG2, kdpC2Different protein complexes
KdpD presenceTruncated KdpD (365 aa)AbsentDistinct regulatory mechanisms
KdpE presenceAbsentAbsentAlternative regulation compared to E. coli
K+ limitation responseNot inducedStrongly inducedkdp2 specialized for K+ limitation
Desiccation responseNot reportedStrongly inducedkdp2 role in desiccation tolerance
TranscriptNot detected under K+ limitation5.3-kb transcriptOperon-specific transcriptional regulation
TranslationNot detected under K+ limitation78 kDa KdpB protein detectedOperon-specific translational control

In Anabaena L-31, the kdp1 operon contains five open reading frames: kdpA1, kdpB1, kdpG1, kdpC1, and a truncated kdpD, while the kdp2 operon has four open reading frames: kdpA2, kdpB2, kdpG2, and kdpC2. Despite both operons containing kdpG (encoding a hydrophobic protein) between the kdpB and kdpC genes, their regulation and expression patterns differ significantly .

The kdp1 operon is not induced under potassium limitation, while the kdp2 operon is strongly induced when potassium levels fall below 50 μM. This differential expression suggests distinct functions for the two operons, with kdp2 specifically adapted for responding to potassium scarcity. Furthermore, only the kdp2 operon shows induction in response to desiccation stress, indicating a potential role in adaptation to terrestrial environments .

What techniques are most effective for studying kdpA2 gene expression?

Several complementary techniques can be employed to comprehensively study kdpA2 gene expression:

TechniqueApplicationAdvantagesLimitationsKey Parameters
qRT-PCRQuantification of kdpA2 mRNA levelsHigh sensitivity, quantitativeRequires appropriate reference genesPrimer design, normalization strategy
Northern blottingDetection of kdp transcriptsVisualizes transcript size (e.g., 5.3-kb for kdp2)Lower sensitivity than qRT-PCRProbe specificity, RNA integrity
Western blottingDetection of KdpB proteinConfirms translation of operonRequires specific antibodiesAntibody specificity, subcellular fractionation
Reporter gene fusionsMonitoring kdpA2 promoter activityReal-time analysis possibleMay alter native regulationReporter selection, fusion design
RNA-SeqTranscriptome-wide expression analysisUnbiased, reveals co-regulated genesComplex data analysisSequencing depth, bioinformatic pipeline
Flow cytometrySingle-cell analysis of expressionReveals population heterogeneityRequires fluorescent reportersGating strategy, controls

Based on the search results, effective approaches for studying kdpA2 expression include qRT-PCR to measure relative expression levels of kdpABC and kdpDE genes under different potassium concentrations. In studies with Anabaena L-31, this technique revealed that kdp gene expression was very low in standard medium (7 mM K+) but greatly increased when K+ concentration was reduced to 0.07 mM or lower .

Northern blotting can detect the specific transcript size, which was found to be 5.3-kb for the kdp2 operon in Anabaena L-31, confirming that kdpA2B2G2C2 genes constitute a polycistronic operon. The transcript appears after 1 hour of K+ starvation, with maximal expression at 3 hours, and disappears within 30 minutes after K+ readdition .

Western blotting with antibodies that cross-react with KdpB can confirm the translation of the operon, as the kdp2 operon expression in Anabaena L-31 resulted in a 78 kDa cross-reacting polypeptide corresponding to KdpB. Subcellular fractionation revealed that KdpB was detected exclusively in membrane fractions, consistent with its role as a membrane-bound ATPase .

For all these techniques, it's essential to carefully control environmental conditions, especially potassium concentrations, as even trace amounts can significantly affect kdpA2 expression. Additionally, time-course experiments are valuable given the dynamic nature of kdpA2 expression in response to changing potassium levels.

How can researchers measure kdpA2 activity in membrane preparations?

Assessing the functional activity of the kdpA2 protein requires specialized techniques focusing on membrane preparations:

TechniqueMeasured ParameterProtocol ElementsControls/CalibrationsData Interpretation
ATPase activity assayATP hydrolysis rateMembrane isolation, phosphate release measurement+/- K+, +/- specific inhibitorsnmol Pi/min/mg protein
K+ uptake measurementRadioactive K+ (⁴²K+) uptakeCell preparation, ⁴²K+ exposure, filtrationTime course, K+ concentration seriespmol K+/min/mg protein
Membrane potential assaysΔΨ changesDiOC₂(3) fluorescence+/- CCCP, red:green fluorescence ratioRelative polarization state
Proton motive force measurementPMF components (ΔpH, ΔΨ)pH-sensitive probes, potentiometric dyesCalibration curvesmV of PMF
ATP determinationIntracellular ATP concentrationLuciferase-based assayATP standardsnmol ATP/mg protein
CCCP susceptibility testingMinimum inhibitory concentrationSerial dilutions of CCCPVarious K+ concentrationsMIC (μg/ml)

Membrane potential can be assessed using cationic fluorescent dyes like DiOC₂(3), which exhibits a higher red:green fluorescence ratio as the cross-membrane potential increases. This approach revealed that kdpA mutants exhibit hyperpolarized membrane potential compared to wild-type strains, and this hyperpolarization is abolished by the proton ionophore CCCP .

The functional consequences of kdpA2 activity on ATP levels can be measured using luciferase-based ATP assays. Studies with kdpA mutants showed a 1.67-fold increase in cellular ATP compared to wild-type strains when grown at standard potassium concentrations (7 mM), with differences disappearing at high potassium concentrations (140 mM) .

Susceptibility to proton ionophores like CCCP can provide indirect evidence of kdpA2 function. The kdpA mutant showed 3-fold higher tolerance to CCCP compared to wild-type strains at standard potassium concentrations, with the difference narrowing at higher potassium levels .

For all these assays, it's critical to control potassium concentrations carefully and to include appropriate controls, such as complemented mutant strains or wild-type strains grown under various potassium concentrations, to confirm the specificity of the observed effects to kdpA2 function.

What approaches are recommended for studying the role of kdpA2 in bacterial stress responses?

Understanding kdpA2's role in stress responses requires multi-faceted experimental approaches:

ApproachApplicationKey MethodsVariables to ControlExpected Outcomes
Growth phenotypingAssess survival under stressGrowth curves, colony countsK+ concentration, stress intensityGrowth rates, survival percentages
Transcriptional profilingIdentify co-regulated genesRNA-Seq, microarray, qRT-PCRTiming of sampling, RNA qualityStress-response networks
Mutagenesis studiesDetermine critical residuesSite-directed mutagenesis, complementationExpression levels, protein stabilityStructure-function relationships
In vivo infection modelsAssess virulence/persistenceAnimal models, cell cultureInoculum size, host factorsColonization, persistence rates
Stress combination assaysEvaluate cross-protectionMultiple stressor applicationOrder, intensity of stressorsSynergistic/antagonistic effects
ProteomicsIdentify stress-induced interactionsCo-IP, mass spectrometryBackground binding, controlsProtein interaction networks

For studying kdpA2's role in potassium limitation stress, researchers should create gradients of potassium concentrations ranging from abundant (>7 mM) to severely limiting (<0.07 mM) and monitor growth, gene expression, and protein levels over time. Comparing wild-type, kdpA2 mutant, and complemented strains can reveal the specific contribution of kdpA2 to stress adaptation .

To investigate the role of kdpA2 in desiccation stress, which has been shown to induce kdp2 expression in Anabaena L-31, researchers can subject cultures to controlled drying conditions while monitoring kdpA2 expression and survival rates. Comparing the response to other stressors that do not induce kdp2 (such as salt stress, pH changes, or heat) can help elucidate the specificity of the kdpA2 response to desiccation .

For organisms with multiple kdp operons, like Anabaena L-31 with kdp1 and kdp2, creating single and double operon knockouts can reveal potential redundancy or specialization in stress responses. The differential expression patterns of kdp1 (not induced by K+ limitation) and kdp2 (strongly induced by K+ limitation and desiccation) suggest distinct roles in stress adaptation that warrant further investigation .

The relationship between kdpA2, ATP levels, and bacterial persistence can be studied by exposing cultures to antibiotics like rifampicin and quantifying persister formation in wild-type versus kdpA2 mutant strains under various potassium concentrations. This approach can provide insights into the mechanistic link between potassium transport, ATP homeostasis, and stress tolerance .

What are the best approaches for recombinant expression and purification of kdpA2?

Recombinant expression and purification of membrane proteins like kdpA2 present unique challenges requiring specialized strategies:

ApproachSystemKey ConsiderationsTroubleshootingYield Optimization
Bacterial expressionE. coli C41(DE3), C43(DE3)Membrane protein-optimized strainsToxicity, inclusion bodiesLower induction temperature (16-20°C)
Yeast expressionPichia pastorisPost-translational modificationsGlycosylation patternsMethanol induction optimization
Insect cell expressionSf9, High FiveEukaryotic folding machineryVirus stock qualityInfection MOI, harvest timing
Cell-free systemsE. coli extracts with lipidsDirect membrane incorporationExtract qualityDetergent/lipid optimization
SolubilizationDetergent screeningMembrane extraction efficiencyProtein activityDetergent:protein ratio
PurificationIMAC, size exclusionTag accessibility, aggregationBuffer optimizationTwo-step purification
Functional reconstitutionProteoliposomesLipid composition, protein orientationActivity assaysProtein:lipid ratio

For successful recombinant expression of kdpA2, consider the following recommendations based on membrane protein expression principles and the specific characteristics of kdpA2:

  • Expression system selection: E. coli C41(DE3) or C43(DE3) strains are recommended for initial attempts, as they are specifically designed for toxic membrane protein expression. For challenging cases, consider Pichia pastoris or insect cell systems, which provide eukaryotic folding machinery beneficial for complex membrane proteins.

  • Expression construct design: Include a purification tag (His6 or Strep-tag II) at either the N- or C-terminus, separated by a flexible linker. For kdpA2, consider co-expression with kdpB2, kdpG2, and kdpC2 to form the complete complex, which may enhance stability and folding.

  • Induction conditions: Use lower temperatures (16-20°C) and reduced inducer concentrations for slower expression, which often improves membrane protein folding. For IPTG-inducible systems, 0.1-0.5 mM IPTG is recommended, with expression continuing for 16-20 hours.

  • Membrane preparation: After cell lysis, carefully isolate membranes by ultracentrifugation (typically 100,000 × g for 1 hour). Wash membranes with high-salt buffer (300-500 mM NaCl) to remove peripherally associated proteins.

  • Solubilization: Screen detergents systematically, starting with milder options like n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or lauryl maltose neopentyl glycol (LMNG). Target a final detergent concentration of 1-2% for solubilization, performed for 1-2 hours at 4°C with gentle agitation.

  • Purification: Use immobilized metal affinity chromatography (IMAC) with carefully optimized imidazole concentrations in both wash and elution buffers. Follow with size exclusion chromatography to separate monomeric protein from aggregates and to exchange into a stabilizing buffer containing lower detergent concentrations (typically 2-3× the critical micelle concentration).

  • Functional verification: Assess ATPase activity using colorimetric phosphate release assays in the presence and absence of potassium. For the complete Kdp complex, measure potassium transport after reconstitution into proteoliposomes.

This approach combines established membrane protein techniques with considerations specific to the Kdp system, maximizing the likelihood of obtaining functional recombinant kdpA2 protein for structural and biochemical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.