Recombinant Potato mop-top virus Movement protein TGB2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Movement protein TGB2; P14; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Potato mop-top virus (isolate Potato/Sweden/Sw) (PMTV)
Target Protein Sequence
MVRNNEIGARPNKYWPVVAAVVAICLFGFLTVTNQKHATQSGDNIHKFANGGQYRDGSKS IKYNCNNPRAYNGSSSNITFSQLFLPVLLIGAALYAYLWFTRPDCSVTCRGDCCRSYGG
Uniprot No.

Target Background

Function

This protein participates in viral genome transport to adjacent plant cells via plasmodesmata, bypassing budding. TGBp2 and TGBp3 are essential for intracellular delivery of TGBp1-containing viral ribonucleoprotein complexes (vRNPs) to plasmodesmata. It can modulate plasmodesmata, increasing their size exclusion limit. While less effective than TGB3, it induces thickening of the host actin cytoskeleton network, likely contributing significantly to cell-to-cell viral movement. It binds single-stranded RNA non-specifically.

Database Links

KEGG: vg:991175

Protein Families
Virgaviridae/benyvirus TGB2 movement protein family
Subcellular Location
Host cell junction, host plasmodesma. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host cytoplasm, host cytoskeleton. Host chloroplast envelope.

Q&A

What is the PMTV TGB2 protein and what is its primary function in viral infection?

The PMTV TGB2 protein is a critical component of the viral triple gene block (TGB) movement protein complex. Its primary function is to facilitate cell-to-cell movement of the viral RNA through plasmodesmata. Research has demonstrated that TGB2 is essential for viral movement, as TGB2-defective PMTV clones are restricted to single cells and incapable of intercellular spread . Functionally, TGB2 appears to increase the size exclusion limit (SEL) of plasmodesmata and associates with multiple cellular membrane systems. Beyond its classical movement function, recent research has revealed TGB2's novel role in targeting viral RNA to chloroplasts, suggesting an expanded functional repertoire that may include involvement in viral replication processes .

How can researchers reliably confirm the functionality of recombinant TGB2 fusion proteins?

To confirm functionality of recombinant TGB2 fusion proteins, researchers should implement a complementation assay approach. The method demonstrated in published research involves:

  • Create a TGB2-defective PMTV clone (e.g., introducing a stop codon to prevent TGB2 translation)

  • Verify that the defective clone is restricted to single cells when expressed alone

  • Co-express the recombinant TGB2 fusion protein with the defective clone

  • Assess whether the fusion protein enables cell-to-cell movement of the defective clone

In successful complementation, researchers observed movement beyond the initially infected cell, often appearing as a halo of fluorescence surrounding the primary infection site . This methodological approach ensures that fusion proteins (such as mRFP-TGB2) retain biological activity despite modification. Additionally, researchers should verify proper subcellular localization patterns consistent with native TGB2, including association with ER membranes, mobile granules, and small vesicular structures before concluding the fusion protein is functionally equivalent to wild-type TGB2.

What are effective two-group experimental designs for studying TGB2 function and interaction with cellular components?

When investigating TGB2 function, researchers can implement several two-group experimental designs that enable robust statistical analysis and clear interpretation of results:

Comparative Localization Design:

  • Experimental group: Cells expressing fluorescently-tagged TGB2 in the context of PMTV infection

  • Control group: Cells expressing fluorescently-tagged TGB2 alone without viral infection

  • Measured outcome: Differences in subcellular localization patterns and dynamics

Functional Complementation Design:

  • Experimental group: TGB2-defective virus complemented with recombinant TGB2 fusion protein

  • Control group: TGB2-defective virus without complementation

  • Measured outcome: Cell-to-cell movement capacity (measured by fluorescent reporter spread)

Protein-Lipid Interaction Design:

  • Experimental group: Purified TGB2 protein exposed to chloroplast-specific lipids

  • Control group: Purified TGB2 exposed to non-chloroplast lipids or buffer-only control

  • Measured outcome: Binding affinity and specificity to different membrane components

The key principle in these designs is the manipulation of a single variable (TGB2 function or presence) while maintaining probabilistically equivalent groups through random assignment, followed by objective measurement of outcomes, typically through quantitative imaging or biochemical assays .

What controls are necessary when studying TGB2 subcellular localization using fluorescent protein fusions?

When investigating TGB2 subcellular localization using fluorescent protein fusions, researchers must implement multiple types of controls to ensure reliable data interpretation:

Expression Level Controls:

  • Express the fusion protein under native viral subgenomic promoter rather than strong constitutive promoters (e.g., 35S) to prevent artifacts from overexpression

  • Compare localizations observed under different expression systems to identify potential aberrations

Fusion Protein Functionality Controls:

  • Verify that the fusion protein complements a TGB2-defective viral clone

  • Ensure the fusion protein can increase plasmodesmal SEL similar to wild-type TGB2

Organelle Co-localization Controls:

  • Include established organelle markers (ER, chloroplasts, etc.) to confirm suspected associations

  • Perform co-localization with multiple independent markers for each suspected target compartment

Temporal Controls:

  • Examine localization at different time points post-expression/infection

  • Document the progression of localization patterns (e.g., initial ER association followed by later chloroplast envelope labeling)

Fixation Artifact Controls:

  • Compare live-cell imaging with fixed specimens to identify potential fixation-induced redistribution

  • Use multiple fixation protocols if fixed specimens are necessary

The comprehensive implementation of these controls helps distinguish genuine biological phenomena from technical artifacts, particularly important given the dynamic nature of TGB2 associations with multiple membrane systems throughout infection.

How does TGB2 associate with chloroplasts and what is the functional significance of this interaction?

TGB2 association with chloroplasts represents an unexpected and significant discovery that expands our understanding of viral protein functions beyond traditional movement roles. The association occurs through several experimentally verified mechanisms:

Association Mechanisms:

  • Direct binding to chloroplast lipids confirmed through protein-lipid interaction assays

  • Temporal progression from ER association to chloroplast envelope labeling during infection

  • Ultrastructural evidence showing TGB2 localization at chloroplast membranes

Functional Significance:

  • Viral RNA Targeting: TGB2 appears to play a role in directing viral RNA to chloroplasts, as evidenced by detection of viral genomic RNA in isolated chloroplast preparations from infected tissues

  • Potential Replication Site: The association suggests chloroplast membranes may serve as sites for viral replication complex assembly

  • Chloroplast Modification: PMTV infection induces abnormal chloroplast morphology, including cytoplasmic inclusions and terminal projections, indicating functional alteration of these organelles

The evidence for this association is multi-faceted, including:

  • Detection of viral coat protein, genomic RNA, and fluorescently-labeled TGB2 in isolated chloroplast preparations

  • In situ localization of viral RNA to chloroplasts in infected tissues

  • Electron microscopy revealing abnormal chloroplast ultrastructure in infected cells

These findings collectively suggest that TGB2 plays a novel role in targeting PMTV to chloroplasts, potentially establishing these organelles as sites for viral replication or other aspects of the viral life cycle.

What molecular mechanisms enable TGB2-mediated cell-to-cell movement of PMTV?

The molecular mechanisms underlying TGB2-mediated cell-to-cell movement involve a coordinated sequence of interactions with cellular membranes and other viral components:

Key Mechanistic Steps:

  • Membrane Association: TGB2 integrates into ER membranes via its two transmembrane domains, creating a topology where both N- and C-termini face the cytoplasm

  • Formation of Mobile Structures: TGB2 associates with mobile granules and small vesicular structures (1-2 μm diameter) that facilitate intracellular trafficking of viral ribonucleoprotein complexes

  • Plasmodesmata Targeting: These TGB2-containing structures target and associate with plasmodesmata, the intercellular channels connecting plant cells

  • SEL Modification: TGB2 increases the size exclusion limit of plasmodesmata, allowing passage of larger molecular complexes than would normally traverse these channels

  • Coordinated Action with Other TGB Proteins: TGB2 functions in concert with TGB1 (which binds viral RNA) and TGB3 (which may direct the complex to plasmodesmata)

The experimental evidence supporting these mechanisms includes complementation assays showing that mRFP-TGB2 enables movement of TGB2-defective viral constructs between cells , and localization studies demonstrating progressive association with different membrane compartments throughout infection.

What explains the paradoxical observations regarding TGB2 localization to multiple subcellular compartments?

The apparently paradoxical observation that TGB2 associates with multiple subcellular compartments (ER, mobile granules, vesicular structures, and chloroplasts) can be explained through several research-supported hypotheses:

Temporal Progression Model:

  • TGB2 associates sequentially with different compartments during the infection cycle

  • Initial ER localization transitions to chloroplast association at later infection stages

  • This progression may reflect changing functional requirements during infection

Membrane Continuity Hypothesis:

  • The association may exploit membrane contact sites between the ER and chloroplasts

  • TGB2 may traffic between compartments via membrane bridges rather than through cytosolic transport

Functional Specialization Theory:

  • Different pools of TGB2 may serve distinct functions:

    • ER/vesicle-associated TGB2 primarily facilitates viral movement

    • Chloroplast-associated TGB2 may support replication or other aspects of viral pathogenesis

What imaging techniques provide the most reliable data on TGB2 subcellular localization?

For optimal visualization and quantification of TGB2 subcellular localization, researchers should employ a strategic combination of imaging techniques:

Confocal Laser Scanning Microscopy (CLSM):

  • Primary technique for live-cell tracking of fluorescently-tagged TGB2

  • Enables visualization of associations with ER membranes, mobile granules, and chloroplasts

  • Allows for time-lapse imaging to track dynamic movement of TGB2-containing structures

  • Resolution: ~200-250 nm laterally, suitable for visualizing organelle-level associations

Electron Microscopy:

  • Essential for ultrastructural studies of infected tissues

  • Enables visualization of abnormal chloroplasts with cytoplasmic inclusions and terminal projections

  • Provides definitive evidence for structural alterations in cellular components during infection

  • Resolution: ~0.5-2 nm, allowing visualization of individual membrane associations

Super-Resolution Microscopy:

  • Techniques such as STED, PALM, or STORM overcome diffraction limits

  • Enables visualization of substructures within TGB2-containing bodies

  • Provides spatial resolution of 20-50 nm for precise localization patterns

  • Particularly valuable for examining plasmodesmata associations

Correlative Light and Electron Microscopy (CLEM):

  • Combines fluorescence and electron microscopy of the same specimen

  • Bridges the resolution gap between light and electron microscopy

  • Allows tracking of specific TGB2-containing structures and subsequent ultrastructural analysis

The most reliable approach integrates multiple imaging modalities, as demonstrated in the research where confocal microscopy findings of TGB2-chloroplast association were corroborated by electron microscopy and biochemical isolation of chloroplasts from infected tissues .

How can researchers effectively isolate and characterize TGB2-containing membrane complexes?

Isolation and characterization of TGB2-containing membrane complexes requires a systematic approach combining subcellular fractionation, biochemical analysis, and functional validation:

Isolation Protocol:

  • Tissue Preparation:

    • Harvest leaf tissue at appropriate time points post-infection

    • Homogenize in isotonic buffer with protease inhibitors to preserve complex integrity

  • Differential Centrifugation:

    • Low-speed centrifugation (1,000-2,000×g) to remove nuclei and intact cells

    • Medium-speed centrifugation (8,000-10,000×g) to collect chloroplasts and large organelles

    • High-speed centrifugation (100,000×g) to pellet microsomal fractions containing ER and vesicles

  • Density Gradient Separation:

    • Layer fractions onto continuous sucrose gradients (20-60%)

    • Centrifuge to separate membrane components based on density

    • Collect fractions and analyze for TGB2 presence by immunoblotting

Characterization Approaches:

  • Immunological Detection:

    • Western blotting of fractions using anti-TGB2 antibodies or detection of fluorescent tag

    • Co-immunoprecipitation to identify interacting proteins

  • Lipid Analysis:

    • Lipidomic profiling of TGB2-containing fractions

    • Protein-lipid overlay assays to determine specific lipid interactions

  • RNA Analysis:

    • RT-PCR detection of viral RNA in isolated fractions

    • RNA-immunoprecipitation to assess direct TGB2-RNA interactions

  • Proteomics:

    • Mass spectrometry analysis of TGB2-containing complexes

    • Identification of host proteins co-purifying with TGB2

This methodological approach has successfully demonstrated the presence of viral coat protein, genomic RNA, and fluorescently-labeled TGB2 in chloroplast preparations from infected leaves, providing strong evidence for the novel association between TGB2, viral RNA, and chloroplasts during PMTV infection .

How should researchers interpret contradictory data regarding TGB2 function when comparing different experimental systems?

When faced with contradictory data regarding TGB2 function across different experimental systems, researchers should implement a systematic approach to data interpretation:

Methodological Analysis Framework:

  • Evaluate Expression Systems:

    • Compare results from 35S promoter-driven expression versus viral subgenomic promoter expression

    • Assess whether observed differences correlate with expression levels

    • Consider whether transient versus stable expression affects outcomes

  • Host Species Considerations:

    • Compare results between different host plants (e.g., Nicotiana benthamiana versus potato)

    • Document species-specific differences in TGB2 localization or function

    • Consider evolutionary differences in host-virus interactions

  • Temporal Dynamics:

    • Compare data collected at different time points post-infection/expression

    • Assess whether contradictions reflect different stages of a dynamic process rather than true inconsistencies

    • Implement time-course studies to resolve apparent contradictions

  • Experimental Conditions:

    • Evaluate temperature, light conditions, and other environmental variables

    • Consider whether contradictions arise from different growth or experimental conditions

    • Standardize conditions when making direct comparisons

Resolution Strategies:

  • Direct Comparison Experiments:

    • Design experiments specifically to test contradictory observations under identical conditions

    • Include both experimental systems in the same study to eliminate inter-laboratory variables

  • Quantitative Analysis:

    • Apply rigorous statistical methods to determine if differences are statistically significant

    • Consider whether contradictions might represent quantitative rather than qualitative differences

  • Mechanistic Investigations:

    • Develop testable hypotheses to explain contradictions

    • Design experiments to identify factors that might mediate differential results

The most productive approach treats contradictions as opportunities to discover new aspects of TGB2 biology rather than as problems to be resolved by determining which result is "correct."

What are the most promising approaches for understanding the chloroplast-associated functions of TGB2?

Future research into chloroplast-associated functions of TGB2 should pursue several complementary directions:

Structure-Function Analysis:

  • Generate a series of TGB2 mutants with targeted modifications in potential chloroplast-targeting domains

  • Assess the impact of these mutations on chloroplast association and viral replication

  • Create chimeric proteins with chloroplast-targeting domains to test sufficiency for localization

In situ Viral RNA Tracking:

  • Develop methods for real-time visualization of viral RNA trafficking to chloroplasts

  • Implement RNA aptamer-based systems (MS2, Pepper RNA) to track viral RNA movement

  • Correlate TGB2 localization with viral RNA trafficking patterns

Chloroplast Proteome Analysis:

  • Compare chloroplast protein composition between healthy and PMTV-infected tissues

  • Identify host proteins that interact with TGB2 at the chloroplast envelope

  • Determine which chloroplast proteins are modified during infection

Viral Replication Studies:

  • Develop assays to directly test whether viral replication occurs at chloroplast membranes

  • Use replication-specific markers to colocalize replication sites with TGB2 and chloroplasts

  • Employ metabolic labeling to track nascent viral RNA synthesis and localization

Comparative Virology Approach:

  • Extend investigations to related viruses to determine whether chloroplast association is unique to PMTV or common among related viruses

  • Compare TGB2 proteins from different viruses for their ability to associate with chloroplasts

These approaches would build on the current evidence suggesting that TGB2 plays a novel role in targeting PMTV to chloroplasts, potentially establishing these organelles as sites for viral replication . The most promising direction involves integrating multiple approaches to develop a comprehensive model of TGB2's multifunctional roles throughout the viral infection cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.