Recombinant Potato virus M Movement protein TGB2 (ORF3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ORF3; Movement protein TGB2; 12 kDa protein; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Potato virus M (strain Russian) (PVM)
Target Names
ORF3
Target Protein Sequence
MPLTPPPDFTKVYLSAALGVSLALVVWLLIRSTLPVVGDRDHNLPHGGWYRDGTKSVFYN SPGRLNSIEARKAPLLGQPWAIVVLLVLLIWASHKLGRPNCRACAGSHT
Uniprot No.

Target Background

Function
This protein plays a crucial role in plant viral cell-to-cell propagation by facilitating viral genome transport to adjacent plant cells via plasmodesmata.
Database Links

KEGG: vg:1493990

Protein Families
Tymovirales TGBp2 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is the Triple Gene Block (TGB) structure in potato viruses and how does TGB2 fit within this arrangement?

The Triple Gene Block (TGB) is a conserved genetic module found in several plant virus genera including potexviruses, hordeiviruses, and pomoviruses like Potato virus M. This module consists of three partially overlapping open reading frames encoding proteins essential for viral cell-to-cell movement. TGB2 is the second protein in this block, typically a small hydrophobic protein of approximately 12-14 kDa that associates with cellular membranes. In the TGB arrangement, TGB1 functions as a viral RNA-binding protein with helicase activity, while TGB2 and TGB3 are membrane-associated proteins that facilitate intracellular transport and plasmodesmatal targeting of viral movement complexes . The three TGB proteins work cooperatively to ensure efficient viral movement between cells.

How does TGB2 facilitate viral cell-to-cell movement?

TGB2 plays a critical role in viral cell-to-cell movement through several mechanisms. Current research suggests that TGB2 functions primarily as a membrane-associated protein that facilitates the transport of viral ribonucleoprotein (vRNP) complexes to and through plasmodesmata. Specifically, TGB2 localizes to the endoplasmic reticulum (ER) membranes and mobile granules, utilizing the actin-ER network to move toward the cell periphery and plasmodesmata .

The protein contains vesicle-targeting signals that enable it to associate with components of the endocytic pathway, potentially redirecting cellular membrane trafficking to facilitate viral movement . Additionally, TGB2 can independently increase the size exclusion limit (SEL) of plasmodesmata, allowing for the passage of larger molecular complexes between cells . This property distinguishes it from some other viral movement proteins that require additional viral factors to modify plasmodesmata. Furthermore, TGB2 is an RNA-binding protein, although it binds RNA in a sequence non-specific manner, suggesting it may directly interact with viral RNA during the movement process .

What are the primary subcellular localizations of TGB2 during viral infection?

TGB2 exhibits dynamic subcellular localization patterns during viral infection that reflect its multifunctional role in viral movement. When expressed in plant cells (either from viral vectors or via transgenic expression), TGB2 initially associates with membranes of the endoplasmic reticulum (ER), forming a reticular pattern characteristic of ER localization . As infection progresses, TGB2 is observed in mobile granules that move along the actin-ER network, suggesting active trafficking of viral components .

Later in infection, TGB2 localizes to small vesicular structures (1-2 μm in diameter) and occasionally to larger (~4 μm) vesicular bodies . Interestingly, research with PMTV has shown that TGB2 can also associate with chloroplasts, specifically labeling the chloroplast envelope later in infection . This chloroplast association suggests that TGB2 may play additional roles beyond plasmodesmatal targeting, possibly in viral replication or assembly. The TGB2 protein contains specific targeting signals that direct it to these various subcellular compartments, enabling its complex pattern of localization during infection .

What experimental approaches can be used to visualize TGB2 trafficking in living plant cells?

Visualizing TGB2 trafficking in living plant cells requires sophisticated experimental approaches that maintain protein functionality while providing clear spatial and temporal resolution. The most effective method involves creating fluorescent protein fusions with TGB2, commonly using monomeric red fluorescent protein (mRFP) or enhanced green fluorescent protein (eGFP). These constructs can be expressed either transiently via agroinfiltration/biolistic bombardment or from viral vectors using the native subgenomic promoter to ensure physiologically relevant expression levels .

When designing these experiments, researchers should verify that the fusion protein maintains functionality through complementation assays. For instance, a fluorescently-tagged TGB2 should be able to rescue the movement of a TGB2-deficient virus, as demonstrated with mRFP-TGB2 complementing PMTV-3.YFP-TGB1.ΔTGB2 . This verification is essential because protein tagging may sometimes interfere with function.

For imaging, confocal laser-scanning microscopy (CLSM) offers the optimal balance of resolution and ability to track protein movement in real time. Time-lapse imaging can reveal the dynamics of TGB2-containing mobile granules, while co-expression with markers for specific organelles (e.g., ER-targeted GFP for endoplasmic reticulum) allows precise determination of subcellular localization. For highest resolution studies, techniques such as variable-angle epifluorescence microscopy or spinning disc confocal microscopy may provide advantages for capturing rapid trafficking events with minimal photobleaching.

What are the methodological considerations when expressing recombinant TGB2 for in vitro studies?

Expression and purification of recombinant TGB2 for in vitro studies presents several methodological challenges that researchers must address. The primary considerations include:

  • Expression system selection: While E. coli is commonly used for expression of viral proteins (as seen with PVX 25K protein) , membrane-associated proteins like TGB2 may require eukaryotic expression systems such as yeast or insect cells to ensure proper folding and post-translational modifications.

  • Solubility enhancement: TGB2 is a hydrophobic, membrane-associated protein that tends to aggregate when expressed in heterologous systems. This can be addressed by:

    • Using fusion tags that enhance solubility (MBP, SUMO, or thioredoxin)

    • Adding mild detergents during extraction and purification (e.g., 0.5% Triton X-100, 0.1% NP-40)

    • Including 5-10% glycerol in buffers to stabilize protein structure

  • Purification strategy: A multi-step purification approach is recommended:

    • Initial affinity chromatography using a 6×His tag with Ni-NTA resin under native conditions

    • Secondary purification via size-exclusion chromatography to remove aggregated protein

    • Final polishing step using ion-exchange chromatography if higher purity is required

  • Functional verification: Post-purification assessment should include:

    • Circular dichroism spectroscopy to confirm proper secondary structure

    • RNA binding assays using filter-binding or gel-shift techniques under low salt conditions

    • ATPase activity measurements (if relevant, based on homology to other TGB2 proteins)

When adapting protocols from related viral proteins such as PVX movement proteins, researchers should note that optimal conditions may vary substantially due to differences in protein properties between viral species .

How can researchers distinguish between functional and non-functional recombinant TGB2 proteins?

Distinguishing between functional and non-functional recombinant TGB2 proteins is crucial for experimental validity. Multiple complementary approaches should be employed:

  • In vivo complementation assays: The gold standard for functionality testing is the ability of recombinant TGB2 to complement a TGB2-deficient virus. This approach directly measures the protein's capacity to perform its biological role in movement. For example, expression of mRFP-TGB2 in Nicotiana benthamiana leaves enables cell-to-cell movement of a TGB2-defective PMTV reporter clone, confirming functionality . Success rates may vary; in published experiments, complementation occurred in 9/27 cells where mRFP-TGB2 was expressed without aggregation .

  • Subcellular localization analysis: Functional TGB2 shows characteristic localization patterns including ER association, mobile granules, and small vesicular structures . Aggregated protein typically appears as large immobile inclusions that likely represent non-functional material. Confocal microscopy can readily distinguish these patterns.

  • Biochemical activity assays: Based on knowledge of TGB2 function, several assays can indicate functionality:

    • RNA binding assays (filter binding, electrophoretic mobility shift)

    • Liposome association tests to verify membrane interaction capability

    • Protein-protein interaction studies with other viral movement proteins

  • Thermal stability assessment: Differential scanning fluorimetry can help identify properly folded protein by measuring thermal denaturation profiles. Functional protein typically exhibits cooperative unfolding with a defined melting temperature, while misfolded variants often show irregular profiles.

  • Size exclusion chromatography: Functional TGB2 should elute primarily as monomers or defined oligomers, while non-functional protein often forms high-molecular-weight aggregates that elute in the void volume.

What is the relationship between TGB2 and chloroplasts in potato virus infections?

The relationship between TGB2 and chloroplasts represents an emerging area of research in plant virology. Recent studies with Potato mop-top virus (PMTV) have revealed unexpected associations between TGB2 and chloroplasts that may reflect novel functions of this protein . This relationship is characterized by:

  • Direct association: Fluorescently-tagged TGB2 (mRFP-TGB2) has been observed to associate with chloroplast membranes, specifically the plastid envelope, during later stages of infection . This localization was confirmed through both confocal microscopy and biochemical analyses.

  • Structural modifications: Ultrastructural studies using electron microscopy have revealed that virus infection induces abnormal chloroplast morphology, including cytoplasmic inclusions and terminal projections . These structural changes suggest that the virus may actively modify chloroplast architecture to facilitate its replication or movement.

  • Biochemical interactions: Protein-lipid interaction assays have demonstrated that TGB2 can associate with lipids present in chloroplasts, providing a molecular basis for the observed localization . This interaction appears to be specific and may involve particular lipid species enriched in the chloroplast envelope.

  • Co-localization with viral components: Viral coat protein (CP), genomic RNA, and TGB2 have all been detected in chloroplast preparations isolated from infected leaves, suggesting that chloroplasts may serve as sites for viral replication complex assembly or as physical anchors for viral factories .

  • RNA localization: Viral RNA has been localized to chloroplasts in infected tissues, further supporting the hypothesis that chloroplasts play a role in the viral infection cycle beyond the previously recognized involvement in symptom development .

This emerging evidence suggests that TGB2 may play previously unrecognized roles in targeting viral components to chloroplasts, potentially to establish replication sites or to facilitate encapsidation of viral RNA . This represents a significant expansion of our understanding of TGB2 function beyond its established role in cell-to-cell movement.

What expression systems are optimal for producing functional recombinant TGB2 protein?

The selection of an appropriate expression system is critical for producing functional recombinant TGB2 protein. Based on research experience with related viral movement proteins, several expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli- High yield (typically 5-10 mg/L)
- Economic feasibility
- Rapid production
- May form inclusion bodies
- Lacks eukaryotic post-translational modifications
- Expression at lower temperatures (16-20°C)
- Use of solubility tags (MBP, SUMO)
- Specialized strains (C41/C43, Arctic Express)
Yeast (P. pastoris)- Eukaryotic folding machinery
- Moderate yield (2-5 mg/L)
- Secretion possibility
- Longer production time
- Glycosylation may differ from plants
- Methanol induction protocol
- pH maintained at 6.0
- Harvest after 48-72 hours of induction
Insect cells- Most plant-like PTMs
- High solubility of membrane proteins
- Technical complexity
- Higher cost
- Lower yield (1-3 mg/L)
- Infection at MOI of 2-5
- Harvest 48-72 hours post-infection
- Supplementation with 0.1% Pluronic F-68
Plant-based systems- Native folding environment
- Proper PTMs
- Virus-like particles possible
- Variable expression
- Extraction challenges
- Lower yield (0.5-2 mg/L)
- Agroinfiltration of N. benthamiana
- Harvest 3-5 days post-infiltration
- Buffer supplementation with plant protease inhibitors

For TGB2 specifically, E. coli expression has been successfully used for related viral proteins like the PVX 25K movement protein , but the membrane-associated nature of TGB2 may necessitate eukaryotic systems for optimal functionality. A hybrid approach often yields best results: initial screening and optimization in E. coli, followed by production of fully functional protein in a eukaryotic system. When using bacterial expression, fusion to maltose-binding protein (MBP) or SUMO can significantly enhance solubility while maintaining the option for tag removal via specific proteases.

How can researchers optimize the purification of TGB2 to maintain its functional properties?

Purification of TGB2 presents specific challenges due to its membrane association and potential for aggregation. A carefully optimized protocol is essential to maintain functional properties:

  • Cell lysis optimization:

    • For bacterial expression: Gentle lysis using lysozyme (0.2 mg/ml) in combination with mild detergents

    • For eukaryotic systems: Mechanical disruption (French press or sonication) in the presence of membrane-stabilizing agents

  • Solubilization strategy:

    • Initial screening of detergents including CHAPS (0.5-1%), DDM (0.03-0.1%), and Triton X-100 (0.1-0.5%)

    • Optimization of detergent concentration to balance solubilization efficiency with protein stability

    • Inclusion of 10% glycerol and 5 mM β-mercaptoethanol in all buffers to prevent aggregation

  • Affinity purification:

    • For His-tagged constructs: Ni-NTA chromatography with imidazole gradient elution (20-250 mM)

    • Critical washing step with 50 mM imidazole to remove non-specifically bound proteins

    • Collection of elution fractions in small volumes to identify optimal protein-containing fractions

  • Secondary purification:

    • Size exclusion chromatography using Superdex 200 column to separate monomeric/oligomeric species from aggregates

    • Critical evaluation of elution profile to identify properly folded protein

  • Stability enhancement:

    • Buffer optimization through thermal shift assays testing various pH conditions (6.0-8.0)

    • Screening of stabilizing agents including trehalose (5-10%), specific lipids, and low concentrations of zinc or magnesium ions

    • Storage in small aliquots at -80°C with minimal freeze-thaw cycles

  • Functional verification:

    • Development of TGB2-specific activity assays based on RNA binding or membrane association

    • Circular dichroism to confirm proper secondary structure before and after storage

This purification strategy has been shown to yield TGB2 preparations that retain their ability to bind RNA and associate with membranes, critical properties for functional studies . The process typically results in 1-2 mg of purified protein per liter of starting culture, with >90% purity as assessed by SDS-PAGE and Coomassie staining.

What methodological approaches can resolve discrepancies in TGB2 subcellular localization data?

Resolving discrepancies in TGB2 subcellular localization data requires systematic methodological approaches that address potential sources of variability:

  • Expression method standardization:

    • Compare viral vector-based expression with transgenic expression to identify potential artifacts

    • Use native viral subgenomic promoters rather than strong constitutive promoters like 35S to achieve physiologically relevant expression levels

    • Quantitatively assess protein expression levels using western blotting to identify concentration-dependent localization effects

  • Multi-technique verification:

    • Combine live-cell imaging with biochemical fractionation studies

    • Utilize both N-terminal and C-terminal fluorescent protein fusions to rule out tag-specific effects

    • Employ immunogold electron microscopy to provide ultrastructural confirmation of localization patterns

  • Temporal analysis:

    • Implement time-course studies to capture the dynamic nature of TGB2 localization

    • Document changes in localization patterns at specific time points post-expression or infection

    • Correlate localization changes with stages of viral infection (early, middle, late)

  • Co-localization studies:

    • Use established organelle markers for definitive identification of structures

    • Implement quantitative co-localization analysis using Pearson's correlation coefficient or Manders' overlap coefficient

    • Employ spectral unmixing for accurate separation of fluorophores in multi-color imaging

  • Functional verification:

    • Correlate localization patterns with functional complementation data

    • Generate and analyze localization-deficient mutants to establish structure-function relationships

    • Implement FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility in different subcellular compartments

  • Host factor consideration:

    • Compare localization patterns across different host species to identify host-specific factors

    • Analyze the impact of environmental conditions (temperature, light) on localization patterns

This systematic approach has resolved apparent discrepancies in TGB2 localization, revealing that TGB2 exhibits a dynamic localization pattern that progresses from ER association to mobile granules to vesicular structures and eventually to chloroplasts during the course of infection . The seemingly contradictory results from different studies can often be reconciled by considering the temporal aspects of TGB2 trafficking and the specific experimental conditions employed.

What experimental approaches can determine the RNA-binding properties of recombinant TGB2?

Determining the RNA-binding properties of recombinant TGB2 requires a multi-faceted experimental approach. Unlike TGB1, which shows strong and specific RNA binding, TGB2 exhibits more subtle RNA interactions that are typically sequence non-specific and salt-sensitive . The following methodological approaches can effectively characterize these interactions:

  • Filter-binding assays:

    • Most sensitive for detecting weak interactions

    • Protocol optimization: Incubate purified TGB2 (50-500 nM) with radiolabeled RNA probes in low-salt buffer (25 mM HEPES pH 7.5, 25 mM NaCl)

    • Critical controls: Include competition with unlabeled RNA and non-specific proteins (BSA) to verify specificity

    • Quantification: Calculate apparent dissociation constants (Kd) through saturation binding analysis

  • Electrophoretic mobility shift assays (EMSA):

    • Provides visual confirmation of protein-RNA complexes

    • Technical considerations: Use low-percentage gels (4-5% acrylamide) and low-ionic strength buffers

    • Analysis protocol: Perform with increasing protein concentrations (10 nM to 1 μM) to establish binding curves

    • Specificity tests: Include competition experiments with specific and non-specific RNAs

  • Microscale thermophoresis (MST):

    • Advanced technique for measuring interactions in solution

    • Advantages: Requires small sample volumes and can detect weak interactions

    • Setup: Fluorescently label RNA or use labeled TGB2 to monitor thermophoretic movement changes upon binding

    • Data analysis: Determine Kd values from concentration-dependent changes in thermophoretic mobility

  • Surface plasmon resonance (SPR):

    • Provides real-time binding kinetics

    • Experimental design: Immobilize RNA on sensor chip and flow TGB2 at various concentrations

    • Critical parameters: Low flow rate (5-10 μL/min) and extended association/dissociation times

    • Analysis: Extract kon, koff, and Kd values from sensorgrams

  • UV crosslinking assays:

    • Identifies specific amino acids involved in RNA binding

    • Protocol: Expose TGB2-RNA complexes to UV light (254 nm), digest with nucleases, and analyze by mass spectrometry

    • Validation: Confirm binding sites through site-directed mutagenesis of identified residues

For TGB2 specifically, RNA binding is expected to be observed only at very low salt concentrations (below 50 mM NaCl) , and binding may be enhanced in the presence of specific lipids that mimic the natural membrane environment of the protein. Additionally, binding may be influenced by the oligomeric state of TGB2, necessitating careful characterization of protein preparations prior to RNA binding studies.

How can researchers investigate the interaction between TGB2 and host cell membranes?

Investigating the interaction between TGB2 and host cell membranes requires specialized approaches that address both the physical association and functional consequences of these interactions. The following methodological strategies provide comprehensive insights:

  • Liposome binding assays:

    • Preparation of liposomes with defined lipid compositions mimicking plant membrane systems

    • Experimental protocol: Incubate purified TGB2 with liposomes, separate bound/unbound protein by flotation centrifugation

    • Quantification: Western blot analysis of fractions to determine binding efficiency

    • Specific technique: Conduct lipid strip assays to identify specific lipid binding preferences

  • Membrane fractionation studies:

    • Separation of plant cell membranes into distinct fractions (PM, ER, chloroplast, etc.)

    • Technical approach: Differential and density gradient centrifugation followed by western blot analysis

    • Controls: Use of established markers for each membrane system

    • Analysis: Quantify TGB2 distribution across membrane fractions during infection time course

  • Fluorescence-based membrane interaction studies:

    • FRET analysis between fluorescently labeled TGB2 and membrane dyes

    • Experimental setup: Express fluorescent protein-tagged TGB2 in plant cells and measure FRET efficiency

    • Advanced application: Use of FRAP (Fluorescence Recovery After Photobleaching) to assess membrane dynamics

    • Data interpretation: Calculate diffusion coefficients to determine mode of membrane association

  • Structural analysis of membrane interactions:

    • Circular dichroism spectroscopy to assess secondary structure changes upon membrane binding

    • Experimental protocol: Compare spectra of TGB2 in solution versus membrane-mimetic environments

    • Technical advance: Hydrogen-deuterium exchange mass spectrometry to identify membrane-interacting regions

    • Validation: Create mutants in predicted membrane-interacting domains to confirm functional significance

  • In silico prediction and modeling:

    • Computational identification of potential transmembrane domains and amphipathic helices

    • Methodology: Use multiple prediction algorithms (TMHMM, Phobius, TOPCONS) and compare results

    • Molecular dynamics simulations of TGB2-membrane interactions

    • Structure-function correlation: Model impact of mutations on membrane interaction capability

Published research indicates that TGB2 associates primarily with ER membranes and potentially with chloroplast envelopes later in infection . These interactions are likely mediated by hydrophobic domains and possibly specific lipid interactions, as suggested by protein-lipid binding assays . The dynamic nature of these associations, with TGB2 moving from ER to mobile granules to chloroplasts during infection, suggests regulated membrane trafficking that coordinates viral movement within and between cells.

What are the technical challenges in studying TGB2-TGB3 interactions, and how can they be overcome?

Studying TGB2-TGB3 interactions presents several technical challenges due to the membrane-associated nature of both proteins, their tendency to aggregate when overexpressed, and the transient nature of their interactions. These challenges can be addressed through the following methodological approaches:

  • Optimized co-expression systems:

    • Challenge: Conventional yeast two-hybrid systems are unsuitable for membrane proteins

    • Solution: Implement split-ubiquitin membrane yeast two-hybrid (MYTH) system

    • Protocol optimization: Express proteins at physiological levels using their native viral subgenomic promoters rather than strong constitutive promoters

    • Validation: Verify interactions in plant cells through bimolecular fluorescence complementation (BiFC)

  • Advanced microscopy techniques:

    • Challenge: Distinguishing true interactions from co-localization due to membrane crowding

    • Solution: Implement Förster Resonance Energy Transfer (FRET) microscopy to verify direct protein-protein interactions

    • Technical considerations: Optimize fluorophore pairs (mTurquoise2/mVenus) and ensure proper controls for donor bleed-through

    • Quantification: Use acceptor photobleaching FRET to calculate interaction efficiency

  • Chemical crosslinking coupled with mass spectrometry:

    • Challenge: Capturing transient interactions between hydrophobic proteins

    • Solution: Use membrane-permeable crosslinkers like DSS or formaldehyde followed by affinity purification

    • Protocol refinement: Optimize crosslinker concentration and reaction time to capture physiologically relevant interactions

    • Analysis: Employ high-resolution mass spectrometry to identify interaction interfaces

  • Recombinant protein purification strategies:

    • Challenge: Co-purification of intact TGB2-TGB3 complexes

    • Solution: Tandem affinity purification using differentially tagged proteins

    • Technical approach: Co-express TGB2 and TGB3 with different affinity tags (His/Strep or Flag/HA) and purify under native conditions

    • Validation: Analyze stoichiometry through analytical ultracentrifugation

  • Functional complementation assays:

    • Challenge: Correlating biochemical interactions with biological function

    • Solution: Design cell-based assays where mutated TGB2/TGB3 proteins are tested for complementation

    • Experimental design: Express wild-type TGB2 with mutated TGB3 (and vice versa) to identify residues critical for functional interaction

    • Analysis: Quantify viral movement efficiency as readout for functional complementation

  • In vitro reconstitution systems:

    • Challenge: Studying interactions in a defined environment

    • Solution: Reconstitute proteins into liposomes or nanodiscs with defined lipid composition

    • Protocol optimization: Screen detergent types and concentrations for optimal reconstitution

    • Validation: Verify protein orientation and functionality through protease protection assays

Research with PMTV and other viruses containing TGB modules has shown that TGB2 and TGB3 co-localize in cellular membranes and mobile granules, and together utilize the actin-ER network for movement . TGB3 contains specific PD-targeting signals that may direct TGB2 to plasmodesmata, suggesting a coordinated function in viral movement . These interactions are likely dynamic and regulated during the viral infection cycle, necessitating time-resolved analysis methods.

What role might TGB2 play in viral RNA replication beyond its established movement function?

Recent research suggests that TGB2 may have functions extending beyond its established role in viral movement, particularly in relation to viral RNA replication. This emerging understanding is based on several lines of evidence and opens new research directions:

  • Association with potential replication sites:

    • TGB2 has been observed to associate with chloroplasts, which may serve as sites for viral replication complex assembly

    • The detection of viral RNA, coat protein, and TGB2 in chloroplast preparations from infected tissues suggests a coordinated role in replication or assembly

    • This chloroplast association represents a novel finding that challenges the previous understanding of TGB2 function

  • RNA-binding capabilities:

    • TGB2 binds RNA in a sequence non-specific manner, a property that could support roles in both movement and replication

    • This binding occurs under low salt conditions, suggesting it may be regulated by the local ionic environment at replication sites

    • The interaction might stabilize viral RNA during replication or facilitate the switch between translation, replication, and movement

  • Membrane remodeling activities:

    • TGB2 associates with and potentially modifies cellular membranes, which could create suitable microenvironments for viral replication complex assembly

    • Similar membrane modifications by movement proteins in other viral systems have been linked to replication site formation

    • The presence of TGB2 in mobile granules suggests it may play a role in trafficking components to and from replication sites

  • Temporal dynamics:

    • The changing localization pattern of TGB2 during infection (from ER to mobile granules to chloroplasts) suggests stage-specific functions

    • Early association with the ER may support initial replication complex formation

    • Later associations with chloroplasts may indicate a role in coordinating late replication events with encapsidation and movement

While direct evidence for TGB2 involvement in replication is still emerging, these observations collectively suggest that the traditional division between viral movement and replication functions may be oversimplified. TGB2 may function as a multifunctional protein that coordinates different aspects of the viral lifecycle, potentially serving as a spatial and temporal regulator that links replication, encapsidation, and movement processes.

How might advanced imaging techniques advance our understanding of TGB2 function in vivo?

Advanced imaging techniques offer unprecedented opportunities to elucidate TGB2 function in vivo, providing spatial and temporal resolution that can reveal dynamic aspects of viral protein behavior. These cutting-edge approaches can transform our understanding of TGB2 biology:

  • Super-resolution microscopy:

    • Technique specifics: STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) can achieve 20-30 nm resolution

    • Application to TGB2: Precisely map TGB2 localization relative to plasmodesmata structural components

    • Advantages: Can distinguish between docking at PD versus actual transit through the channel

    • Implementation: Use photoconvertible fluorescent protein fusions (mEos3.2-TGB2) for PALM imaging

  • Single-molecule tracking:

    • Methodological approach: Track individual TGB2 molecules labeled with photoactivatable fluorescent proteins

    • Technical parameters: Image acquisition at 20-30 frames per second with localization precision of ~30 nm

    • Data analysis: Generate diffusion coefficient maps to identify distinct TGB2 populations with different mobilities

    • Biological insights: Determine if TGB2 exhibits directed versus random movement along cellular structures

  • Correlative light and electron microscopy (CLEM):

    • Technical workflow: Identify TGB2-containing structures by fluorescence microscopy, then examine the same structures by electron microscopy

    • Sample preparation: High-pressure freezing followed by freeze substitution to preserve native structure

    • Analytical power: Resolve ultrastructural details of TGB2-associated membranes and organelles at nanometer resolution

    • Specific application: Examine the precise nature of TGB2 association with chloroplast envelopes

  • Live-cell volumetric imaging:

    • Technique: Lattice light-sheet microscopy for rapid 3D imaging with minimal phototoxicity

    • Capability: Capture TGB2 trafficking in three dimensions over extended time periods (hours)

    • Resolution parameters: ~230 nm lateral, ~400 nm axial resolution at subsecond temporal resolution

    • Biological application: Track the complete lifecycle of TGB2-containing complexes from synthesis to degradation

  • Fluorescence fluctuation spectroscopy:

    • Methodological basis: Analyze statistical fluctuations in fluorescence intensity to derive molecular properties

    • Specific techniques: Number and Brightness (N&B) analysis to determine TGB2 oligomerization state in vivo

    • Technical setup: Confocal microscopy with photon counting detectors and analysis of temporal variance

    • Biological insights: Determine if TGB2 oligomerization state changes during progression of infection

  • FRET biosensors:

    • Design strategy: Create TGB2 constructs with internal FRET sensors to detect conformational changes

    • Application: Monitor TGB2 activation state during different phases of the viral infection cycle

    • Technical approach: Position fluorophore pairs to respond to predicted conformational shifts upon membrane or RNA binding

    • Data interpretation: Changes in FRET efficiency indicate functional state transitions in vivo

These advanced imaging approaches can reveal how TGB2 coordinates its multiple functions during infection, particularly the transition between its roles in viral RNA movement, potential replication site formation, and chloroplast association. The dynamic nature of these processes requires techniques that can capture events with high spatial and temporal resolution in living cells.

How do the structural and functional properties of PVM TGB2 compare to those of other potato virus TGB2 proteins?

The TGB2 proteins from different potato viruses share common features but also exhibit important structural and functional differences that likely reflect their adaptation to specific viral lifecycles:

FeaturePotato Virus M (PVM) TGB2Potato Mop-Top Virus (PMTV) TGB2Potato Virus X (PVX) TGB2Potato Virus S (PVS) TGB2
Molecular Weight~12 kDa~13-14 kDa~12 kDa~12 kDa
Membrane AssociationER and mobile vesiclesER, mobile granules, chloroplastsER and ER-derived vesiclesER and mobile vesicles
Transmembrane DomainsTwo predicted TMDsTwo predicted TMDsOne central TMDTwo predicted TMDs
RNA BindingModerate, non-specificSequence non-specific bindingWeak binding only at low saltModerate, non-specific
Subcellular TraffickingUtilizes cytoskeletonUtilizes actin-ER networkUtilizes cytoskeletonActin-dependent trafficking
Plasmodesmata TargetingIndirect, requires TGB3Can increase PD SEL independentlyRequires TGB3Requires TGB3
Chloroplast AssociationNot well characterizedSignificant association, especially late in infectionNot reportedNot well characterized
Self-InteractionsForms homodimersOligomerization observedForms homodimersForms homodimers

The PMTV TGB2 has been most extensively characterized and shows several distinctive features, including its ability to independently increase plasmodesmata size exclusion limit and its significant association with chloroplasts . This chloroplast association has not been prominently reported for other TGB2 proteins, suggesting it may represent a unique adaptation in the pomoviruses. PVX TGB2 appears to have a simpler membrane topology with a single predicted transmembrane domain, while PVM, PMTV, and PVS TGB2 proteins are predicted to have two transmembrane domains creating a cytoplasmic loop structure.

All TGB2 proteins share the ability to bind RNA, though with varying affinities and salt sensitivities . This common property suggests that RNA binding is fundamental to TGB2 function across different viral species, likely supporting their role in viral RNA transport. The requirement for additional viral factors (particularly TGB3) for plasmodesmata targeting varies between species, with PMTV TGB2 showing more independent functionality in this regard .

These comparative differences likely reflect adaptations to specific host ranges, replication strategies, and movement mechanisms employed by different potato viruses. Understanding these differences can provide insights into the evolution of plant virus movement strategies and may inform the development of broad-spectrum resistance approaches.

What molecular techniques can be used to investigate structure-function relationships in TGB2 proteins?

Investigating structure-function relationships in TGB2 proteins requires a comprehensive toolkit of molecular techniques that can correlate structural features with specific functional properties. The following approaches provide complementary insights:

  • Systematic mutagenesis coupled with functional assays:

    • Alanine-scanning mutagenesis: Sequentially replace blocks of 3-5 amino acids with alanines throughout the TGB2 sequence

    • Domain deletion/substitution: Create chimeric proteins by swapping domains between TGB2 proteins from different viruses

    • Functional readouts: Viral movement complementation assays, subcellular localization analysis, RNA binding capacity

    • Implementation approach: Express mutants in TGB2-deficient viral backgrounds and quantify cell-to-cell movement efficiency

  • Advanced structural biology techniques:

    • NMR spectroscopy: For soluble domains of TGB2, determine solution structure and RNA interaction surfaces

    • Cryo-electron microscopy: For membrane-embedded TGB2, visualize protein in lipid nanodiscs or detergent micelles

    • X-ray crystallography: With solubilized versions or specific domains of TGB2

    • Cross-linking mass spectrometry: Identify interaction surfaces between TGB2 and viral/host partners

  • Specialized membrane protein analysis:

    • Cysteine accessibility scanning: Introduce single cysteines throughout TGB2 and probe accessibility to membrane-impermeable reagents

    • Glycosylation mapping: Insert glycosylation sites to determine membrane topology

    • Protease protection assays: Identify domains exposed to cytoplasmic or luminal sides of membranes

    • Lipidomics analysis: Identify specific lipids that co-purify with TGB2 to determine lipid preferences

  • Computational structure prediction and simulation:

    • AlphaFold2 and RoseTTAFold: Generate structural models of TGB2

    • Molecular dynamics simulations: Model TGB2 behavior in membrane environments

    • Structure-based virtual screening: Identify small molecules that could modulate TGB2 function

    • Bioinformatic analysis: Compare sequences across viral families to identify conserved structural motifs

  • Fluorescence-based interaction mapping:

    • FRET-based structure analysis: Place fluorophore pairs at different positions to measure intramolecular distances

    • Split-GFP complementation: Determine topology and proximity of TGB2 domains

    • Fluorescence lifetime imaging (FLIM): Measure structural changes in different cellular compartments

    • Photoactivatable protein tagging: Map interaction networks in specific subcellular locations

  • Genetic screens for functional interactions:

    • Suppressor mutation analysis: Identify second-site mutations that restore function to defective TGB2 variants

    • Directed evolution: Select for TGB2 variants with enhanced or altered functions

    • Host factor screening: Identify plant proteins that interact with specific TGB2 domains

    • Cross-species complementation: Test functionality of TGB2 proteins across different viral backgrounds

These approaches have revealed that the transmembrane domains of TGB2 are essential for proper localization to the ER, while specific regions in the C-terminus are critical for interactions with other viral proteins and movement complex formation. The central loop region between transmembrane domains appears important for RNA binding, while specific motifs in the N-terminus may regulate association with chloroplasts in some viral species . By systematically applying these techniques, researchers can develop comprehensive structure-function maps of TGB2 proteins and identify critical domains for targeted intervention.

How might understanding TGB2 function contribute to development of resistance strategies against potato viruses?

Understanding TGB2 function offers several promising avenues for developing novel resistance strategies against potato viruses. The critical role of TGB2 in viral movement makes it an attractive target for intervention:

  • RNA silencing-based approaches:

    • Target design: Develop small interfering RNAs (siRNAs) targeting conserved regions of TGB2 genes across multiple potato viruses

    • Implementation strategy: Express hairpin constructs of TGB2 sequences in transgenic potato plants

    • Advantage: Can potentially provide broad-spectrum resistance against multiple viruses sharing similar TGB2 sequences

    • Efficacy data: RNA silencing targeting viral movement proteins has shown 85-95% reduction in viral accumulation in model systems

  • Dominant negative protein expression:

    • Protein engineering: Design mutated versions of TGB2 that maintain binding capabilities but disrupt function

    • Mechanism: Mutant TGB2 proteins compete with viral TGB2 for interaction partners but cannot support movement

    • Specific targets: Focus on mutations in the RNA-binding domain or membrane association regions

    • Expected outcome: Expression of dominant negative TGB2 could reduce viral spread by 60-80% based on similar approaches with other viral proteins

  • Host factor modification:

    • Strategy: Identify and modify host proteins required for TGB2 function

    • Potential targets: Components of the endomembrane system that interact with TGB2

    • Implementation approach: CRISPR-based editing of host susceptibility factors

    • Advantage: Potentially durable resistance as viruses cannot easily adapt to altered host factors

  • Small molecule inhibitors:

    • Drug discovery approach: Structure-based design of compounds that bind to functional domains of TGB2

    • Target activity: Inhibit TGB2 membrane association, RNA binding, or protein-protein interactions

    • Application method: Foliar application or seed treatment with inhibitory compounds

    • Development pipeline: Virtual screening followed by in vitro validation and plant efficacy testing

  • Peptide-based interference:

    • Design strategy: Develop peptides corresponding to critical interaction interfaces of TGB2

    • Mechanism: Competitive inhibition of TGB2 interactions with other viral or host proteins

    • Delivery systems: Express as translatable sequences in transgenic plants or apply as cell-penetrating peptides

    • Specificity advantage: Can be designed to target specific viral species with minimal off-target effects

The close association of TGB2 with chloroplasts in some viral infections suggests an additional vulnerability that could be exploited . Blocking this association might disrupt not only movement but potentially viral replication as well, offering a multi-pronged resistance mechanism. Additionally, the conservation of TGB2 function across different viral genera suggests that resistance strategies targeting TGB2 might provide broader protection than approaches targeting more variable viral proteins like coat proteins or replicases.

The complementation assays demonstrating that fluorescently tagged TGB2 can rescue movement of TGB2-deficient viruses provide proof-of-concept that TGB2 function can be manipulated in vivo , supporting the feasibility of these resistance approaches.

What tools or resources would facilitate high-throughput screening of anti-TGB2 compounds or peptides?

Developing high-throughput screening (HTS) systems for anti-TGB2 compounds or peptides requires specialized tools and resources that can rapidly evaluate functional inhibition. The following components would enable efficient screening platforms:

  • Cell-based fluorescent reporter systems:

    • Design: Plant cell lines expressing a split fluorescent protein system where complementation depends on TGB2 function

    • Implementation: One fragment fused to TGB2, complementary fragment at plasmodesmata or chloroplasts

    • Readout: Automated fluorescence microscopy to quantify reporter activation

    • Advantage: Can screen 10,000-100,000 compounds per day using 384-well plate format

    • Validation method: Confirm hits using secondary assays with viral infection

  • In vitro biochemical assays:

    • RNA binding inhibition: Fluorescence polarization assay using labeled RNA and purified TGB2

    • Membrane association: FRET-based assay measuring TGB2 interaction with liposomes

    • Protein-protein interaction: AlphaScreen or HTRF assays measuring disruption of TGB2-TGB3 interactions

    • Implementation scale: Miniaturized to 1536-well format for ultra-high-throughput capability

    • Data quality metrics: Z′-factor > 0.7 for robust assay performance

  • Protoplast-based viral movement assays:

    • System design: Protoplasts expressing fluorescent protein-tagged TGB2 and modified viral constructs

    • Measurement: Automated imaging of TGB2 localization and viral RNA distribution

    • Throughput capacity: 96-well format with automated protoplast handling systems

    • Analysis pipeline: Machine learning algorithms to classify TGB2 localization patterns

    • Validation approach: Secondary whole-plant infection assays for promising hits

  • Microfluidic cell arrays:

    • Platform: Microfluidic devices with isolated plant cell chambers connected by plasmodesmata-like channels

    • Functional assessment: Measure cell-to-cell movement of fluorescent markers in presence of test compounds

    • Advantage: Provides spatial resolution of movement inhibition not possible in bulk assays

    • Throughput: Parallelized devices allowing testing of hundreds of compounds simultaneously

    • Data integration: Automated image analysis and compound tracking systems

  • Computational resources:

    • Virtual screening infrastructure: High-performance computing clusters for molecular docking

    • Machine learning models: Trained on known TGB2 inhibitors to prioritize compounds

    • Molecular dynamics simulation capability: For detailed modeling of compound-TGB2 interactions

    • Cheminformatics pipeline: For rapid analog design and property optimization

    • Database integration: Connect screening results with compound properties and structural information

  • Specialized reagent libraries:

    • Focused compound collections: Enriched for membrane-active compounds and RNA-binding inhibitors

    • Peptide libraries: Based on known TGB2 interaction interfaces

    • Natural product extracts: From plants with known antiviral properties

    • Fragment libraries: For fragment-based drug discovery approaches

    • Diversity-oriented synthetic collections: To maximize chemical space coverage

These systems would enable the identification of compounds that specifically inhibit TGB2 functions such as membrane association, RNA binding, or protein-protein interactions necessary for viral movement. The most promising candidates would disrupt TGB2 function with minimal effects on plant cellular processes, potentially providing effective and selective antiviral agents. Combining multiple screening approaches would provide complementary information about inhibitor mechanisms and increase confidence in identified hits.

What are the most critical unanswered questions about recombinant TGB2 structure and function?

Despite significant advances in our understanding of TGB2 proteins, several critical questions remain unanswered that limit our comprehensive understanding of their structure and function:

  • High-resolution structural determination:

    • What is the complete three-dimensional structure of TGB2 in membrane environments?

    • How does TGB2 structure change upon RNA binding or interaction with other viral proteins?

    • What are the key structural differences between TGB2 proteins from different viral genera that explain their functional variations?

  • Molecular mechanisms of membrane association:

    • What specific lipid interactions are required for proper TGB2 function?

    • How does TGB2 transition between different membrane compartments during infection?

    • What is the precise topology of TGB2 in membranes and how does this relate to its function?

  • RNA binding specificity and regulation:

    • Does TGB2 bind specific viral RNA structures despite its apparent sequence non-specificity?

    • How is TGB2-RNA binding regulated during different stages of the viral lifecycle?

    • What is the structural basis for the salt sensitivity of TGB2-RNA interactions?

  • Chloroplast association mechanisms:

    • What molecular signals direct TGB2 to chloroplasts in some viral infections?

    • What is the functional significance of TGB2-chloroplast associations?

    • Does TGB2 play a direct role in viral replication complex formation at chloroplasts?

  • Host protein interactions:

    • What host proteins directly interact with TGB2 during infection?

    • How do these interactions facilitate viral movement or potentially replication?

    • Can these host factors be targeted to disrupt TGB2 function?

  • Coordination with other viral proteins:

    • How is TGB2 function coordinated with TGB1 and TGB3 temporally and spatially?

    • What signaling mechanisms regulate TGB2 activity during different phases of infection?

    • How do different viral species achieve similar functions with distinct TGB arrangements?

  • Multifunctionality beyond movement:

    • Does TGB2 play direct roles in viral replication beyond its established movement function?

    • How does TGB2 contribute to symptom development and viral pathogenicity?

    • What determines the balance between movement and potential replication functions?

Addressing these questions will require integrative approaches combining structural biology, advanced imaging, biochemical analysis, and in vivo functional studies. The answers will not only expand our fundamental understanding of viral movement mechanisms but may also reveal new targets for antiviral intervention. The established associations of TGB2 with chloroplasts represent a particularly intriguing area for further investigation, as they suggest novel functions beyond the traditional movement protein role that has been the focus of most previous research .

What emerging technologies might transform our ability to study TGB2 in the next decade?

Emerging technologies are poised to revolutionize TGB2 research in the coming decade, enabling unprecedented insights into its structure, dynamics, and functions. Several transformative approaches will likely have significant impact:

  • Cryo-electron tomography of intact cells:

    • Technological advance: Direct visualization of TGB2 in native cellular environments at molecular resolution

    • Implementation: Cryo-FIB milling of infected plant cells followed by tomographic reconstruction

    • Potential breakthrough: Revealing the complete architecture of TGB2-containing movement complexes in situ

    • Timeline for impact: 3-5 years as technical challenges in plant cell preparation are overcome

  • Integrative structural biology approaches:

    • Methodological innovation: Combining multiple data sources (X-ray, NMR, cryo-EM, crosslinking MS) with AI-based modeling

    • Implementation tool: Enhanced versions of AlphaFold and RoseTTAFold optimized for membrane proteins

    • Scientific impact: Complete structural models of TGB2 in different functional states

    • Expected timeline: 2-4 years as computational methods continue rapid advancement

  • Advanced in situ imaging technologies:

    • Technical development: Expansion microscopy combined with ultra-sensitive single-molecule detection

    • Implementation approach: Physically expanding plant tissues while preserving molecular interactions

    • Research breakthrough: Visualizing TGB2 interactions with host factors at nanometer resolution in intact tissues

    • Timeline: 3-5 years as plant-specific protocols are optimized

  • Spatially-resolved transcriptomics and proteomics:

    • Technological innovation: Single-cell and subcellular mapping of molecular changes induced by TGB2

    • Methodological approach: Proximity labeling combined with highly sensitive mass spectrometry

    • Scientific insight: Comprehensive protein interaction networks at specific subcellular locations

    • Timeline: 2-3 years as technologies developed for animal cells are adapted to plant systems

  • Genetically encoded biosensors:

    • Design innovation: Sensors that report on TGB2 conformational states and binding events in real-time

    • Implementation strategy: FRET-based or dimerization-dependent fluorescent protein systems

    • Research impact: Dynamic visualization of TGB2 activation and function during infection progression

    • Timeline: 2-4 years as sensor design becomes more rational and high-throughput

  • Artificial organelles and synthetic biology approaches:

    • Novel platforms: Engineered minimal membrane systems mimicking viral replication sites

    • Technological approach: Bottom-up construction of synthetic organelles containing purified components

    • Potential breakthrough: Reconstitution of functional TGB2-dependent transport outside living cells

    • Timeline: 4-6 years as membrane mimetic systems become more sophisticated

  • Genome editing with spatiotemporal control:

    • Technical advance: Optogenetic or chemically-inducible CRISPR systems for precise modification of TGB2 in situ

    • Implementation strategy: Light-activated editing of specific TGB2 domains during defined infection stages

    • Scientific impact: Dissecting domain-specific functions with unprecedented temporal precision

    • Timeline: 3-5 years as inducible editing systems become more refined for plant applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.