Recombinant Potato virus X Movement protein TGBp3 (ORF4)

Shipped with Ice Packs
In Stock

Description

Introduction to TGBp3 and Its Recombinant Form

Recombinant Potato virus X (PVX) Movement Protein TGBp3 (ORF4) is a bioengineered version of the viral protein encoded by the ORF4 gene in PVX. It is expressed in heterologous systems (e.g., E. coli) and used to study its role in viral cell-to-cell movement and replication. TGBp3 is part of the triple gene block (TGB), a conserved genetic module in plant viruses that coordinates intracellular trafficking and intercellular spread .

Key characteristics of the recombinant TGBp3 include:

PropertyDetails
SourceExpressed in E. coli (His-tagged)
Protein LengthFull-length (1–70 amino acids)
Amino Acid SequenceMEAGAYLNAIIFVLVATIIAVISRGLTRTEPCTIRITGESITVHACHIDSETIKALANLKPLSLERLSFQ
ApplicationsSDS-PAGE analysis, structural studies, and functional assays

Association with Host Membranes

TGBp3 localizes to the endoplasmic reticulum (ER) and induces membrane-derived vesicles critical for virus movement . Mutations disrupting its membrane-binding ability impair both TGBp3 trafficking and PVX spread .

Role in Viral Movement

TGBp3 facilitates cell-to-cell movement by interacting with:

  1. TGBp1: Required for TGBp3 localization in Nicotiana tabacum .

  2. TGBp2: Acts as a molecular bridge between TGBp3 and viral replication complexes .

Table 1: Functional Interactions of TGBp3

Interaction PartnerRoleEvidence
TGBp1Recruits TGBp3 to plasmodesmataDisrupted movement in N. tabacum
TGBp2Binds RdRp/dsRNA bodies via “chain mail” structuresRequired for TGBp3 localization
ER-derived vesiclesServes as transport platformsColocalizes with ER markers

Coordination with Replication Complexes

TGBp3 aggregates alongside RdRp/dsRNA bodies, which are covered by TGBp2 “chain mail” structures . This interaction enhances viral replication by stabilizing replication compartments .

Dependence on Host Membrane Dynamics

  • Brefeldin A (BFA): Disrupts ER networks, inhibiting TGBp3 movement .

  • Cerulenin: Blocks de novo membrane synthesis, impairing PVX replication .

Synergy with TGBp2 in Movement

TGBp2’s C-terminal domain directly binds RdRp, anchoring TGBp3 to replication complexes . Knockout of TGBp2 abrogates both replication and movement, underscoring its dual role .

Experimental Models

  • Biolistic Bombardment: Used to study TGBp3 movement between cells .

  • Infectious Clones: Deletion mutants (e.g., ΔTGBp3) reveal protein-specific effects on virus spread .

Challenges and Limitations

  • Protein Instability: TGBp3 has a shorter half-life in virus-infected cells, complicating tracking .

  • Host-Specific Requirements: TGBp3 movement efficiency varies between Nicotiana species .

Comparative Analysis with Related Viruses

Table 2: TGBp3 Functions Across Viruses

VirusTGBp3 RoleKey Features
PVXER-associated movement proteinRequires TGBp1 in N. tabacum
Potato Mop-Top VirusInduces motile granules along actinDepends on TGBp2 for localization
Barley Stripe MosaicInteracts with replication complexesShares conserved TGBp2-TGBp3 interactions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF4; Movement protein TGBp3; 7 kDa protein; Triple gene block 3 protein; TGBp3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-70
Protein Length
full length protein
Species
Potato virus X (strain CP) (PVX)
Target Names
ORF4
Target Protein Sequence
MEAGAYLNAIIFVLVATIIAVISRGLTRTEPCTIRITGESITVHACHIDSETIKALANLKPLSLERLSFQ
Uniprot No.

Target Background

Function
Plays a role in viral cell-to-cell propagation by facilitating genome transport to neighboring plant cells through plasmodesmata. It may induce the formation of granular vesicles derived from the Endoplasmic reticulum, which align on actin filaments.
Protein Families
Tymovirales TGBp3 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is the subcellular localization of PVX TGBp3?

TGBp3 primarily localizes to the endoplasmic reticulum (ER) and ER-derived membrane structures. Confocal and electron microscopic observations have demonstrated that TGBp3 and the PVX replicase co-localize in membrane-bound structures derived from the ER. This has been confirmed through multiple methodological approaches:

  • Confocal microscopy using PVX infectious clones expressing green fluorescent protein (GFP) reporters

  • Immunolocalization with antisera detecting the PVX replicase and host membrane markers

  • Sucrose gradient fractionation showing that TGBp3 co-fractionates with ER marker proteins

Importantly, there is no evidence indicating that TGBp3 moves into the Golgi apparatus, suggesting its function is restricted to the ER and ER-derived structures .

How is TGBp3 expressed during PVX infection?

TGBp3 is expressed at relatively low levels during natural PVX infection through a complex translational mechanism:

  • It is expressed from a bicistronic subgenomic RNA

  • Expression occurs by translational read-through of the upstream TGBp2 open reading frame (ORF)

  • This low-level expression may be biologically significant, as higher expression levels (such as when expressed from heterologous vectors) can trigger defense responses that may not occur during natural infection

When studying TGBp3 function, researchers must consider these expression dynamics, as artificially high expression levels may lead to phenotypes not representative of natural infection processes.

What is the relationship between TGBp3 and the viral replicase?

The PVX replicase and TGBp3 demonstrate a close spatial relationship within infected cells:

  • Both proteins localize to ER-derived membrane structures

  • A subset of TGBp3 resides in the ER at precisely the same location as the replicase

  • Sucrose gradient fractionation confirms that both proteins co-fractionate with ER marker proteins

  • This co-localization likely represents a functional region where both proteins are synthesized and/or function during viral infection

This spatial relationship suggests potential functional cooperation between these proteins during the viral life cycle, though the exact molecular mechanisms of their interaction require further investigation.

How does TGBp3 induce the unfolded protein response?

TGBp3 functions as a specific elicitor of the unfolded protein response (UPR) through mechanisms that have been characterized using various experimental approaches:

  • When expressed from a Tobacco mosaic virus (TMV) vector (TMV-p3), TGBp3 triggers rapid upregulation of several ER-resident chaperones, including:

    • BiP (ER luminal binding protein): 30-35 fold increase within 8 hours

    • PDI (protein disulphide isomerase): 30-35 fold increase within 8 hours

    • CRT (calreticulin): ~15 fold increase within 8 hours

    • CAM (calmodulin): ~15 fold increase within 8 hours

This response is specific to TGBp3, as TMV expressing TGBp2 (TMV-p2) does not induce comparable UPR gene expression. The response requires the intact membrane-association domain of TGBp3, as a mutant lacking the N-terminal transmembrane domain (TMV-p3Dm1) fails to induce significant UPR .

The data suggest TGBp3 acts as a specific molecular trigger for UPR signaling, potentially through its interaction with ER membranes and subsequent perturbation of ER homeostasis.

What are the molecular mechanisms underlying TGBp3-mediated programmed cell death?

TGBp3-mediated programmed cell death (PCD) involves several coordinated molecular pathways:

  • TGBp3 expression from TMV vector (TMV-p3) induces HR-like local lesions with hallmarks of PCD:

    • Increased reactive oxygen species

    • DNA fragmentation

    • Positive staining of dead cells with Evans blue dye

    • Induction of SKP1 expression

The PCD process appears to be regulated through several mechanisms:

  • TGBp3-mediated cell death is suppressed in plants that overexpress BiP, indicating that UPR induction by TGBp3 initially functions as a pro-survival mechanism

  • Anti-apoptotic genes (Bcl-xl, CED-9, Op-IAP) fail to alleviate TGBp3-induced PCD

  • TGBp3-mediated cell death is reduced in SKP1-silenced Nicotiana benthamiana plants, suggesting SKP1-dependent regulation

Interestingly, during natural PVX infection, this cell death response may be limited by low TGBp3 expression levels or by interactions with other viral proteins like TGBp2, which may act as a "guard molecule" preventing TGBp3 from binding cellular receptors that trigger defense responses .

How do researchers differentiate between TGBp3's roles in viral movement versus host defense induction?

Distinguishing between TGBp3's movement functions and its role in triggering host defenses requires careful experimental design:

  • Expression level considerations: During natural PVX infection, TGBp3 is expressed at low levels, which may limit defense induction while maintaining movement functions

  • Mutational analysis: Targeted mutations in TGBp3 can separate movement functions from defense-triggering capabilities

  • Vector-based expression: TMV-based expression of TGBp3 reveals that it can induce defense responses independently of other PVX proteins

  • Protein-protein interaction studies: TGBp2 may interact with TGBp3 during natural infection to regulate its defense-triggering properties

What is the relationship between TGBp3-induced UPR and membrane proliferation during PVX infection?

TGBp3 plays a crucial role in the modification of host endomembrane systems during PVX infection:

  • PVX replication relies on ER-derived membrane recruitment and membrane proliferation

  • Cerulenin, a drug that inhibits de novo membrane synthesis, also inhibits PVX replication

  • TGBp3-induced UPR likely contributes to membrane modifications through:

    • Upregulation of ER resident chaperones

    • Possible activation of lipid biosynthesis pathways

    • Alteration of ER structure to create replication-competent membranes

The temporal relationship between UPR induction and membrane proliferation suggests that TGBp3-triggered UPR precedes and potentially facilitates the membrane modifications necessary for efficient viral replication and movement.

What expression systems are optimal for studying TGBp3 function?

Different expression systems offer distinct advantages for TGBp3 research:

Expression SystemAdvantagesLimitationsTypical Applications
TMV Vector- Rapid expression (within hours)
- Systemic spread
- Consistent expression levels
- Allows study of early events
- Potential for virus interactions
- May trigger defense responses
- UPR induction studies
- Host gene expression analysis
- Systemic effects
Agroinfiltration (35S:TGBp3)- Localized expression
- No viral competition
- Expression maintained for 2-5 days
- Slow expression onset (2 days)
- No systemic spread
- Variable expression levels
- Localized studies
- Protein interaction studies
- Long-term expression
Natural PVX infection- Native expression context
- Natural protein ratios
- All viral components present
- Low TGBp3 expression levels
- Difficult to isolate TGBp3 effects
- Authentic virus-host interactions
- Movement studies
- Replication complex formation

TMV vector expression has been particularly valuable for studying TGBp3-induced host responses, allowing detection of gene expression changes within 8 hours post-inoculation, whereas agroinfiltration requires several days to achieve adequate expression levels .

How can researchers effectively generate and analyze TGBp3 mutants?

Mutational analysis of TGBp3 requires systematic approaches:

  • Transmembrane domain mutations:

    • Deletion of the N-terminal transmembrane domain causes cytosolic accumulation and loss of UPR-inducing activity

    • Point mutations in membrane-interacting residues can distinguish between membrane association and function

  • Chloroplast-targeting signal analysis:

    • Methods differentiating between signal peptides and transmembrane domains can identify targeting signals

    • Analysis of Alternanthera mosaic virus (AltMV) TGBp3 revealed chloroplast-targeting properties distinct from PVX TGBp3

  • Visualization approaches:

    • TGBp3-GFP fusions allow real-time tracking in living cells

    • Use of AltMVΔTGB3(TGB3-GFP+) constructs facilitates visualization without interference from native TGBp3

  • Functional complementation:

    • Testing whether mutant TGBp3 can restore movement to TGBp3-deficient viruses

    • Assessing whether mutants retain ability to induce UPR or cell death

Researchers should carefully consider the potential impact of tags and fusion proteins on TGBp3 function, as its small size (8 kDa) means modifications may significantly affect structure and function.

What approaches can resolve contradictions in TGBp3 research findings?

Contradictory findings regarding TGBp3 function can be addressed through several methodological approaches:

  • Expression level standardization:

    • Quantify TGBp3 expression levels across different systems

    • Use inducible promoters to control expression timing and intensity

  • Cell type and developmental considerations:

    • Document the developmental stage and cell types studied

    • Compare results across different plant tissues and cell types

  • Viral context analysis:

    • Study TGBp3 both in isolation and in the context of other viral proteins

    • Consider whether TGBp2 modulates TGBp3 activity during natural infection

  • Host genetic background control:

    • Use standardized plant genotypes

    • Compare results across different host species and varieties

    • Consider silencing host factors (e.g., SKP1) to assess their role in observed phenotypes

A comprehensive framework that accounts for these variables can help reconcile seemingly conflicting observations about TGBp3 function in different experimental contexts.

How might TGBp3 be targeted for antiviral interventions?

TGBp3's essential roles in viral movement and membrane modification make it a potential target for antiviral strategies:

  • Small molecule inhibitors targeting TGBp3-membrane interactions could disrupt viral movement

  • Peptides interfering with TGBp3-TGBp2 interactions might enhance defense-triggering properties

  • Engineering plant resistance by modifying host factors that interact with TGBp3

Future research should explore:

  • Structural characterization of TGBp3 to identify druggable sites

  • High-throughput screening for compounds that disrupt TGBp3 function

  • Engineering plant resistance by modifying TGBp3 recognition or response systems

What omics approaches could advance TGBp3 research?

Integrative omics approaches could reveal new insights into TGBp3 function:

Omics ApproachPotential ApplicationsExpected Insights
Proteomics- TGBp3 interaction partners
- Post-translational modifications
- Temporal changes in protein complexes
- Identification of host targets
- Regulatory mechanisms
- Pathway connections
Transcriptomics- Global gene expression responses
- Temporal dynamics of UPR
- Host defense pathways
- Comprehensive UPR signature
- Secondary response pathways
- Species-specific responses
Lipidomics- Membrane composition changes
- Lipid metabolism alterations
- Replication complex composition
- Membrane modification mechanisms
Metabolomics- Metabolic reprogramming
- Energy allocation during infection
- Bioenergetic requirements
- Metabolic vulnerabilities

Combined with advanced imaging techniques such as super-resolution microscopy and correlative light and electron microscopy, these approaches could provide a systems-level understanding of TGBp3 function.

How do TGBp3 functions compare across different potexviruses?

Comparative analysis of TGBp3 proteins from different potexviruses can provide evolutionary and functional insights:

  • Alternanthera mosaic virus (AltMV) TGBp3 contains a chloroplast-targeting signal not present in PVX TGBp3

  • Different potexviruses may exhibit varying dependencies on actin and myosin for cell-to-cell movement

  • Structural conservation versus functional divergence of TGBp3 across the potexvirus family remains to be fully characterized

Systematic comparison of TGBp3 proteins across potexviruses, combined with chimeric virus approaches, could reveal conserved functional domains and species-specific adaptations that contribute to host range, tissue tropism, and virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.