Recombinant Potorous tridactylus Occludin (OCLN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
OCLN; Occludin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Potorous tridactylus (Potoroo)
Target Names
Target Protein Sequence
MMYEKRSYTGYGHPSSHYDYPPPSGPPGSFYLADVPPQHFYQWRSPPGIVRILQGSVVIL CLVIFACVASTLAWEYYGSGGLLGYGGGLGSYYNGYYGGYNGYYYGGLTNPRAANGFMIA MAVLCFLVTLGLVIAGLSKASGARSRRFYLLVAVLSGLLAFVMLIASIVYVVGVNPRAGL GASSGSLYYNQMLMLCNQMMSPVAGGIMNQYLYHYCMVDPQEAVAIVCGFLTVILLCVIC YFAQKTRHKIWKYGKPNIFWDKPLATAEGPNVEEWVKNVSGDVGTQDETATLAYSEKPIS PLTSAFLPAQENGYGHSTPSSPSVPPPEGPSPPEEKDKGSVSRPPARRGHRQRPRPTGLE ESQYETDYTTAAESSGEQNRDDWASLYPPIISDAIRQTYKAEFNNDLQRYKALCAEMDDI GTQLRQLSHELDCLPEGSLRYQGVAEEYNRLKDLKRSPEYQSKKLETQSLRDKLCHIKRM VGGYDQSRS
Uniprot No.

Target Background

Function
Occludin (OCLN) may play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
Protein Families
ELL/occludin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Tissue Specificity
Localized at tight junctions of both epithelial and endothelial cells.

Q&A

What is the basic structure of occludin and how does it function in tight junctions?

Occludin is a four-pass integral plasma-membrane protein that functions as a critical component of tight junctions. Its structure includes two extracellular loops bounded by NH2- and COOH-terminal cytoplasmic domains. The protein plays a functional role in the paracellular barrier, contributing to the selective diffusion barrier between epithelial and endothelial cells that prevents free passage of molecules and ions across the paracellular pathway . As a member of the Marvel (MAL-related proteins for vesicle trafficking and membrane link) domain-containing protein family, occludin shares characteristics with proteins involved in vesicle trafficking and association with lipid rafts, cholesterol, and/or caveolin .

How do Potorous tridactylus occludin characteristics compare with occludin from other mammalian species?

While the search results don't specifically address Potorous tridactylus (long-nosed potoroo) occludin characteristics, comparative studies of occludin across species have shown conservation of key structural domains. Research indicates that the COOH-terminus of occludin is well-documented for binding to intracellular proteins, while the NH2-terminus has been found to bind specifically to the multidomain of E3 ubiquitin-protein ligase Itch, consisting of four WW motifs . When designing experiments with recombinant Potorous tridactylus occludin, researchers should consider these conserved binding domains while acknowledging potential species-specific variations that might affect experimental outcomes.

What methods are most effective for detecting recombinant occludin in experimental systems?

Immunofluorescence analysis remains one of the most effective methods for detecting recombinant occludin in experimental systems. This approach allows visualization of occludin localization both at cell contacts and in intracellular compartments . For quantitative assessment, immunoblotting techniques can determine protein expression levels, as demonstrated in studies comparing occludin expression in uninduced and induced cell lines . Co-immunoprecipitation experiments have successfully validated interactions between occludin and binding partners, such as the E3 ubiquitin-protein ligase Itch, confirming these associations both in vivo and in vitro .

What expression systems are optimal for producing functional recombinant Potorous tridactylus occludin?

For optimal expression of functional recombinant occludin, inducible expression systems such as Tet-Off cell lines have proven effective in experimental settings. The MDCK II Tet-Off system has successfully achieved fourfold increased expression of occludin compared to control levels upon removal of doxycycline . For eukaryotic expression in transient transfection experiments, HEK 293 and Cos-7 cells cultured in DMEM medium supplemented with 10% FCS have been utilized . When designing expression systems for Potorous tridactylus occludin, researchers should consider incorporating epitope tags to facilitate detection and purification while ensuring that these modifications do not interfere with protein folding or function.

How can researchers reliably assess barrier function when studying recombinant occludin effects?

Multiple complementary approaches should be employed to reliably assess barrier function when studying recombinant occludin:

  • Transepithelial Electrical Resistance (TER): Measure TER using epithelial voltohmmeter systems. Studies have demonstrated that occludin overexpression can result in a greater than twofold increase in TER in induced cells compared to uninduced controls .

  • Paracellular Flux Assays: Assess permeability using graded series of PEG oligomers or fluorescent tracers like FITC-dextran at various molecular weights (4, 10, 70, or 500 kDa) and fluorescein. This approach allows researchers to distinguish between permeability through small claudin-based pores (<4 Å radius) versus the leak pathway for larger solutes (>4 Å radius) .

  • Experimental Setup: Cells should be plated on gelatin-coated transwell chambers (0.4 μm pores) at densities of 1×10⁴ cells per well. After reaching confluence (typically day 5), experimental treatments can be applied, and permeability and flux measurements should be performed from days 8-21 in culture .

Permeability MarkerConcentrationMeasurement Parameters
FITC-dextran (4-500 kDa)1 mg/mlEx: 485 nm, Em: 535 nm
Fluorescein0.1 mg/mlEx: 485 nm, Em: 535 nm
Sampling frequencyEvery 60 min for 4 hoursFrom outer chamber

What challenges are commonly encountered when working with recombinant occludin and how can they be addressed?

Common challenges when working with recombinant occludin include:

  • Maintaining Native Conformation: Occludin's multiple transmembrane domains make proper folding challenging. Solution: Use mammalian expression systems rather than bacterial systems and optimize purification conditions to maintain native protein conformation.

  • Variability in Experimental Outcomes: Studies have shown that differences in occludin effects on barrier function can result from variations in cell handling procedures, culture conditions, or clonal differences . Solution: Standardize experimental protocols, include appropriate controls, and develop inducible expression systems that allow for direct comparison of effects in the same cell line with and without occludin expression.

  • Distinguishing Direct vs. Indirect Effects: Determining whether observed barrier changes are directly attributable to occludin versus secondary effects on other junction proteins. Solution: Complement overexpression studies with knockdown approaches and rescue experiments to confirm specificity, as demonstrated in studies where occludin knockdown cells with inducible re-expression restored sensitivity to barrier-disrupting agents like Latrunculin A .

How does occludin contribute to cytokine-mediated regulation of tight junction barriers?

Occludin plays a critical role in cytokine-mediated regulation of tight junction barriers. Research has demonstrated that overexpression of occludin increases the magnitude of barrier responses to proinflammatory cytokines. When MDCK cells overexpressing occludin were treated with IFNγ (100 ng/ml) and TNFα (30 ng/ml) for 24 hours, they exhibited a significantly larger increase in TER (2.2-fold compared to 1.7-fold in uninduced cells) and enhanced paracellular flux of fluorescein-labeled 3-kDa dextran (more than threefold increase versus less than twofold in uninduced cells) .

Conversely, knockdown of occludin attenuates barrier disruption induced by proinflammatory cytokines. After 24 hours of treatment with IFNγ and TNFα, occludin knockdown cells showed only a 20% increase in TER compared to nearly twofold increase in parental cells. Additionally, while cytokine treatment significantly increased dextran flux in control cells, it failed to increase flux above untreated levels in occludin knockdown cells . This bidirectional evidence from both overexpression and knockdown studies strongly indicates that occludin is required for the full manifestation of cytokine effects on tight junction barrier function.

What is the relationship between occludin, the actin cytoskeleton, and barrier regulation?

Occludin interacts with the actin cytoskeleton, and this relationship is critical for barrier regulation. Experimental evidence has shown that:

  • Actin Depolymerization Response: Depolymerization of F-actin with Latrunculin A results in a concentration- and time-dependent drop in TER in epithelial cells, and this disruption is dependent on occludin internalization .

  • Occludin Expression Affects Sensitivity: Overexpression of occludin results in a faster drop in TER after Latrunculin A administration, while knockdown of occludin significantly decreases the rate of TER reduction in response to Latrunculin A compared to parental cell lines .

  • Rescue Experiments Confirm Specificity: When occludin knockdown cells were engineered to inducibly re-express occludin, sensitivity to Latrunculin A was restored to levels observed in parental lines, confirming that the altered response to actin depolymerization was specifically due to occludin depletion rather than clonal variation .

These findings suggest that occludin serves as a mechanosensitive component of tight junctions, potentially transducing cytoskeletal changes into altered barrier properties. Researchers investigating Potorous tridactylus occludin should consider this relationship when designing experiments to study barrier dynamics.

What techniques can be used to investigate occludin ubiquitination and its functional implications?

Several techniques can be employed to investigate occludin ubiquitination:

  • Yeast Two-Hybrid Screening: This approach has successfully identified novel interactions between occludin and the E3 ubiquitin-protein ligase Itch, specifically demonstrating that the NH2-terminal portion of occludin binds to Itch's multidomain consisting of four WW motifs .

  • Co-Immunoprecipitation: Both in vivo and in vitro co-immunoprecipitation experiments have confirmed the interaction between occludin and ubiquitin ligases like Itch .

  • Proteasome Inhibition Studies: Evidence indicates that the degradation of occludin is sensitive to proteasome inhibition, suggesting that ubiquitination targets occludin for proteasomal degradation. Researchers can use proteasome inhibitors to assess whether recombinant Potorous tridactylus occludin undergoes similar regulatory processes .

  • Ubiquitination Assays: Direct assessment of occludin ubiquitination can be performed using in vivo ubiquitination assays, comparing the extent of ubiquitination under various experimental conditions to understand how this post-translational modification affects occludin function and turnover .

The functional implications of occludin ubiquitination include regulation of tight junction protein levels, potentially allowing for dynamic remodeling of the barrier in response to physiological or pathological stimuli.

How do glucocorticoids affect occludin expression and barrier function?

Glucocorticoids directly regulate occludin expression and significantly enhance barrier function. Research has demonstrated that hydrocortisone increases barrier properties of brain capillary endothelial cells (BCECs) by inducing enhanced expression of occludin via binding of the activated glucocorticoid receptor to putative glucocorticoid responsive elements in the occludin promoter .

In murine immortalized BCEC culture systems, treatment with 110 nm hydrocortisone was shown to induce differentiation of BCECs to a phenotype that shares principal features of the blood-brain barrier (BBB) in vivo. This effect appears to be specific to glucocorticoids and essential for the proper induction and maintenance of complex tight junctions in BCECs and epithelia of various origins .

The molecular mechanism involves direct transcriptional regulation, as the activated glucocorticoid receptor binds to responsive elements in the occludin promoter, leading to increased expression. When studying recombinant Potorous tridactylus occludin, researchers should consider the potential for species-specific variations in glucocorticoid responsiveness and promoter structure.

What experimental approaches can determine the effects of pharmacological agents on occludin-mediated barrier function?

To determine the effects of pharmacological agents on occludin-mediated barrier function, researchers can employ the following experimental approaches:

  • Transwell Barrier Assessment Systems: Cells expressing recombinant occludin can be plated on gelatin-coated transwell chambers to assess barrier function after pharmacological treatment. Both electrical resistance (TER) and molecule flux measurements should be performed to comprehensively characterize barrier properties .

  • Dose-Response and Time-Course Studies: When testing agents like Latrunculin A that affect the actin cytoskeleton, concentration- and time-dependent effects should be assessed. For example, studies have shown varying rates of TER decrease after treatment with 0.25, 0.5, and 1 μM Latrunculin A in control versus occludin-knockdown cells .

  • Comparative Studies Using Genetically Modified Cells: Experimental designs should include:

    • Wild-type cells (baseline)

    • Occludin-overexpressing cells (to detect sensitization)

    • Occludin-knockdown cells (to detect resistance)

    • Rescue cell lines with inducible occludin re-expression (to confirm specificity)

  • Combined Treatments: Testing interactions between multiple agents (e.g., glucocorticoids with insulin) can reveal synergistic or antagonistic effects. For example, cells can be treated with 110 nm hydrocortisone, 110 nm hydrocortisone/1 μm insulin, or 1 μm insulin alone to assess differential effects on barrier properties .

How might recombinant Potorous tridactylus occludin be utilized in developing improved blood-brain barrier models?

Recombinant Potorous tridactylus occludin could significantly contribute to improved blood-brain barrier (BBB) models in several ways:

  • Enhanced Barrier Properties: Controlled expression of recombinant occludin in immortalized brain capillary endothelial cell (BCEC) lines could help achieve the extremely tight permeability characteristic of brain endothelium in vivo (∼2000–5000 Ωcm²), which is not usually preserved in cell lines (∼50–100 Ωcm²) .

  • Glucocorticoid-Responsive Systems: Since glucocorticoids enhance barrier function through occludin upregulation, engineering systems with recombinant occludin under glucocorticoid-responsive promoters could create more physiologically relevant BBB models. Treatment with 110 nm hydrocortisone has been shown to induce differentiation of BCECs to a phenotype sharing key features with the in vivo BBB .

  • Species Diversity in BBB Models: While mouse models are commonly used for BBB studies due to genetic modification possibilities, incorporating occludin from diverse species like Potorous tridactylus might reveal evolutionarily conserved or divergent aspects of tight junction regulation that could inform broader understanding of BBB function across species .

  • Combination with Other Junction Components: Co-expression with additional tight junction proteins like claudin-5, claudin-1, claudin-3, and ZO-1 could create more complete barrier models, particularly when studying the integration of multiple signaling pathways that regulate barrier integrity .

What methodological approaches can resolve contradictory findings regarding occludin's role in barrier regulation?

Several methodological approaches can help resolve contradictory findings about occludin's role in barrier regulation:

  • Standardized Barrier Assessment: Contradictory results regarding occludin's effects on mannitol flux versus other permeability measures highlight the need for standardized, multi-parameter barrier assessment. Researchers should employ both electrical resistance measurements and molecule flux assays using tracers of different sizes to comprehensively characterize barrier properties .

  • Distinction Between Pore and Leak Pathways: Utilizing permeability assays with graded series of PEG oligomers can separately reveal permeability of small claudin-based pores (<4 Å radius) from the leak pathway for larger solutes (>4 Å radius), resolving apparent contradictions where TER changes without corresponding alterations in tracer flux .

  • Controlled Expression Systems: Developing precisely controllable expression systems (like the Tet-Off system) allows direct comparison of barrier properties in the same cell line with different levels of occludin expression, eliminating confounding variables from clonal differences or culture conditions .

  • Complementary Gain and Loss of Function: Combining occludin overexpression, knockdown, and rescue experiments in the same study provides more robust evidence of occludin's specific effects. This approach has successfully demonstrated occludin's role in cytokine and Latrunculin A responses, where both overexpression and knockdown had complementary effects .

  • Context-Dependent Analysis: Recognizing that occludin's effects may depend on experimental context helps explain apparently contradictory findings. For example, while occludin knockout mice showed structurally normal tight junctions, they exhibited numerous physiological abnormalities in multiple organs, suggesting context-dependent functions beyond basic barrier formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.