Recombinant Praomys jacksoni Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Praomys jacksoni Cytochrome c Oxidase Subunit 2 (MT-CO2)

Praomys jacksoni, commonly known as Jackson's soft-furred mouse, is a rodent species belonging to the Muridae family . Recombinant Praomys jacksoni Cytochrome c oxidase subunit 2 (MT-CO2) is a partially synthesized protein derived from this species, produced using recombinant DNA technology . MT-CO2, also known as Cytochrome c oxidase polypeptide II, is a subunit of the Cytochrome c oxidase enzyme complex . This enzyme is essential for the electron transport chain, a critical process in cellular respiration that occurs within the mitochondria of eukaryotic cells .

Characteristics of Recombinant Praomys jacksoni MT-CO2

Recombinant proteins, like Praomys jacksoni MT-CO2, are produced in host cells such as E. coli and are often tagged to aid in purification . The recombinant protein is available in both liquid and lyophilized forms. For liquid form, the shelf life is generally 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C . It is recommended to avoid repeated freezing and thawing, and working aliquots can be stored at 4°C for up to one week .

Table 1: Characteristics of Recombinant Praomys jacksoni MT-CO2

CharacteristicDescription
Product CodeCSB-EP657831PDAI1
AbbreviationMT-CO2
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
Uniprot No.Q38RX1
Product TypeRecombinant Protein
Immunogen SpeciesPraomys jacksoni (African forest rat) (Jackson's soft-furred mouse)
Purity>85% (SDS-PAGE)
SourceE. coli
Target NamesMT-CO2
Protein NamesRecommended name: Cytochrome c oxidase subunit 2; Alternative name(s): Cytochrome c oxidase polypeptide II
NotesRepeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Tag InfoTag type is determined during the manufacturing process.
Protein LengthPartial
ReconstitutionBriefly centrifuge prior to opening. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Default final concentration of glycerol is 50%.
Shelf LifeLiquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C.

Function and Biological Role

Cytochrome c oxidase ( কমপ্লেক্স IV) is a crucial enzyme in the mitochondrial electron transport chain . It catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing oxygen to water . This process is coupled with the pumping of protons across the inner mitochondrial membrane, contributing to the generation of a proton gradient that drives ATP synthesis .

Phylogeography and Genetic Variation

Phylogenetic studies of Praomys jacksoni reveal distinct genetic variations among different geographical locations . For instance, samples from Mt. Kenya form a monophyletic clade that is sister to clades from other localities such as Mt. Elgon, Cherangani, Kakamega, Mau, and Loita . This genetic structuring highlights the geographical effects on the species' phylogeny .

Table 2: Time Estimates for Praomys jacksoni

TaxonMean2.5% Quantile97.5% Quantile
Praomys jacksoni2.291.243.55

Environmental Impact and Conservation

Climate change and human-driven habitat changes significantly impact the distribution and survival of Praomys jacksoni . Models predict a reduction in suitable habitats in the Albertine Rift and East African mountains, with a progressive decline in moderately to highly suitable areas . Land-use analyses indicate steady forest declines and cropland increases in the species' ranges, further threatening their habitats .

Research Applications

Recombinant MT-CO2 can be utilized in various research applications, including:

  • Enzyme kinetics studies Investigating the catalytic mechanisms and efficiency of Cytochrome c oxidase.

  • Structural biology Determining the three-dimensional structure of the protein to understand its function.

  • Drug discovery Screening for potential inhibitors or modulators of Cytochrome c oxidase activity.

  • Phylogenetic studies Comparing the MT-CO2 sequence across different species to understand evolutionary relationships.

  • Understanding responses to environmental changes Studying the physiological impacts of increased carbon dioxide levels on mammalian health outcomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Praomys jacksoni (African forest rat) (Jackson's soft-furred mouse)
Target Names
Target Protein Sequence
MAYSFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function

Recombinant Praomys jacksoni Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (subunit 1), a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cytochrome c Oxidase Subunit 2 in cellular respiration?

Cytochrome c Oxidase Subunit 2 (COII/MT-CO2) plays an essential role in cellular energy production as a core component of cytochrome c oxidase (Complex IV) in the mitochondrial electron transport chain. This highly conserved protein directly facilitates the initial transfer of electrons from cytochrome c to cytochrome c oxidase, a crucial step in the production of ATP during cellular respiration . The protein contains a dual core CuA active site that serves as the primary electron acceptor from cytochrome c before transferring electrons to other subunits within the complex .

For researchers studying Praomys jacksoni MT-CO2, it's important to note that while the core electron transfer function is conserved across species, species-specific variations may affect interaction efficiency with other respiratory components. Experimental approaches should include comparative oxygen consumption measurements, spectrophotometric assays of cytochrome c oxidation rates, and analysis of ATP production when comparing wild-type and recombinant variants.

How conserved is the MT-CO2 gene across rodent species and what are the evolutionary implications?

While studying conservation patterns in MT-CO2 requires genomic comparison across rodent lineages, research on other species provides valuable methodological insights. Studies of marine copepod populations have revealed surprising levels of divergence in COII despite its critical functional role, with interpopulation differences approaching 20% at the nucleotide level, including numerous nonsynonymous substitutions . This suggests that even essential respiratory proteins can exhibit significant variation.

For Praomys jacksoni MT-CO2 research, conservation analysis should include:

  • Multiple sequence alignment with MT-CO2 from related murid rodents

  • Calculation of nucleotide and amino acid divergence rates

  • Analysis of selection pressures using dN/dS ratios

  • Identification of regions under purifying versus positive selection

  • Mapping conservation patterns onto structural domains, particularly the CuA binding site

Such analyses provide insights into evolutionary forces shaping mitochondrial genome evolution in African rodents and may reveal adaptive signatures related to environmental conditions or metabolic demands.

What expression systems are most effective for producing functional recombinant MT-CO2?

Based on successful expression of similar mitochondrial proteins, several systems merit consideration for recombinant Praomys jacksoni MT-CO2 production:

Bacterial Expression Systems:
E. coli expression has proven effective for cytochrome c oxidase subunit II from other species. The approach typically involves:

  • Cloning the MT-CO2 coding sequence into vectors like pET-32a with affinity tags

  • Expression in specialized strains such as Transetta(DE3)

  • Induction with IPTG under optimized conditions (concentration, temperature, duration)

  • Purification via affinity chromatography using Ni(2+)-NTA agarose

Alternative Expression Systems:
For challenging mitochondrial proteins or when post-translational modifications are critical:

  • Yeast systems (S. cerevisiae, P. pastoris) provide eukaryotic processing machinery

  • Insect cell/baculovirus systems offer higher yields of complex proteins

  • Mammalian cell expression may preserve species-specific modifications

When evaluating expression systems, researchers should verify protein functionality through activity assays measuring cytochrome c oxidation. UV-spectrophotometry and infrared spectrometry analyses can confirm that recombinant MT-CO2 maintains catalytic capability comparable to the native protein .

What purification strategies yield the highest activity retention for recombinant MT-CO2?

Purifying functional recombinant MT-CO2 requires careful consideration of protein stability and the integrity of the copper-containing active site. An effective purification strategy involves:

Extraction and Initial Capture:

  • Cell lysis under mild conditions to prevent protein denaturation

  • Inclusion of appropriate detergents for membrane protein solubilization

  • Affinity chromatography (typically using histidine tags) as the initial capture step

  • Careful optimization of imidazole concentrations during washing and elution steps

Secondary Purification Steps:

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography for removing similarly sized contaminants

  • Consideration of hydroxyapatite chromatography for difficult separations

Critical Quality Control Measures:

  • SDS-PAGE and western blotting to confirm identity and purity

  • Spectroscopic analysis to verify integrity of the CuA center

  • Activity assays to confirm functional protein recovery

Research with similar proteins has achieved concentrations of approximately 50 μg/mL of functionally active protein using affinity chromatography with Ni(2+)-NTA agarose . Throughout purification, monitoring the characteristic spectral properties of the CuA center provides a valuable indicator of protein integrity.

What methodological approaches can detect MT-CO2 activity in experimental systems?

Multiple complementary approaches provide robust assessment of MT-CO2 functional activity:

Spectrophotometric Assays:
The primary approach involves monitoring the oxidation of reduced cytochrome c, measured as a decrease in absorbance at 550 nm over time. This assay directly evaluates the electron transfer function and can be performed under varying conditions to determine:

  • Reaction kinetics (Vmax, Km)

  • Effects of pH, temperature, and ionic strength

  • Inhibitor sensitivity

  • Substrate specificity

Oxygen Consumption Measurements:
Clark-type oxygen electrodes or optical oxygen sensors provide direct assessment of the ultimate electron acceptor in the respiratory chain, offering a physiologically relevant measure of complex IV function.

Coupled Enzyme Assays:
When studying MT-CO2 in the context of intact cytochrome c oxidase or respiratory chain complexes, coupled assays measuring ATP production or membrane potential formation provide functional assessment in reconstituted systems.

Published research has successfully used UV-spectrophotometry to analyze the catalytic activity of recombinant COII by measuring its ability to oxidize cytochrome c substrate . Researchers should include appropriate controls such as heat-inactivated enzyme preparations and specific inhibitors to validate assay specificity.

How do post-translational modifications affect the function of MT-CO2 in electron transport?

Post-translational modifications (PTMs) significantly influence respiratory chain protein function, though specific data on Praomys jacksoni MT-CO2 modifications remains limited. Research on cytochrome c provides valuable comparative insights, showing that phosphorylation affects binding with cytochrome c oxidase, altering association and dissociation kinetics and ultimately affecting respiratory efficiency .

To investigate PTMs in MT-CO2:

  • Identification approaches:

    • Mass spectrometry-based proteomics to map modification sites

    • Comparison with known PTM patterns in other mammals

    • Targeted analysis of conserved motifs for phosphorylation, acetylation, or oxidative modifications

  • Functional characterization:

    • Site-directed mutagenesis to create phosphomimetic variants (Ser/Thr→Glu/Asp)

    • Enzyme kinetics comparing wild-type and modified proteins

    • Analytical ultracentrifugation to assess effects on complex formation

  • Physiological relevance:

    • Correlation with metabolic state or environmental conditions

    • Changes in PTM patterns under stress conditions

    • Species-specific differences in modification patterns

PTMs may represent an important regulatory mechanism for fine-tuning respiratory chain activity in response to metabolic demands or environmental challenges, potentially contributing to the ecological adaptation of Praomys species to diverse African habitats.

What molecular mechanisms contribute to species-specific variations in MT-CO2 function?

Understanding the molecular basis of species-specific variations in MT-CO2 requires integrating structural, functional, and evolutionary analyses:

Structural determinants:
Key regions that may exhibit species-specific adaptations include:

  • The CuA binding domain containing the metal center

  • Interfaces with other cytochrome c oxidase subunits

  • Cytochrome c binding regions

  • Transmembrane domains

Adaptive molecular mechanisms:
Several mechanisms may contribute to functional differences:

  • Amino acid substitutions affecting redox potential of the CuA center

  • Modifications altering protein stability under different temperature regimes

  • Changes in interaction surfaces affecting complex assembly

  • Alterations in proton pathway components

Experimental approaches:

  • Site-directed mutagenesis to introduce or reverse species-specific substitutions

  • Kinetic analysis under varying temperature, pH, and ionic conditions

  • Comparative structural modeling based on resolved cytochrome c oxidase structures

  • Hybrid systems mixing components from different species

Studies of marine copepods have revealed that while most COII codons are under strong purifying selection, approximately 4% evolve under relaxed selective constraint, and some sites show evidence of positive selection . Similar patterns may exist in Praomys lineages, potentially reflecting adaptation to diverse ecological niches across Africa.

How do specific mutations in MT-CO2 affect electron transport chain efficiency and mitochondrial function?

Mutations in MT-CO2 can significantly impact respiratory chain function, with consequences for cellular energy metabolism and potentially organismal fitness. Research approaches to investigate these effects include:

Site-directed mutagenesis targeting:

  • Conserved residues in the CuA binding domain

  • Species-specific amino acid substitutions

  • Known or predicted phosphorylation sites

  • Interfaces with other subunits

Comprehensive functional assessment:
Mutational effects should be evaluated through multiple parameters:

ParameterMethodologyExpected Impact of Disruptive Mutations
Electron transfer rateCytochrome c oxidation assaysDecreased rate/altered kinetics
Oxygen consumptionClark electrode measurementsReduced O₂ utilization
ATP productionLuciferase-based ATP assaysLower ATP synthesis
ROS generationFluorescent indicators (e.g., H₂DCF-DA)Increased ROS production
Complex assemblyBlue Native PAGEImpaired complex formation

Physiological context:
Mutations should be studied in relevant cellular systems to assess:

  • Effects on mitochondrial membrane potential

  • Impacts on cellular respiration capacity

  • Consequences for cell viability under stress

Studies in yeast have demonstrated that cytochrome c oxidase-deficient mutants show clear phenotypic effects that can be detected using specific staining methods . Additionally, research has shown interactions between cytosolic processes and mitochondrial function, highlighting the importance of studying mutations in appropriate cellular contexts .

What techniques best characterize the interaction between MT-CO2 and cytochrome c?

Investigating the interaction between MT-CO2 and cytochrome c requires methods that can capture the dynamics of this critical electron transfer partnership while maintaining physiologically relevant conditions:

Biophysical interaction analysis:

  • Analytical Ultracentrifugation: Provides binding affinities and complex stoichiometry under varying conditions such as ionic strength

  • Surface Plasmon Resonance: Enables real-time measurement of association and dissociation kinetics

  • Isothermal Titration Calorimetry: Yields thermodynamic parameters (ΔH, ΔS, ΔG) of the binding interaction

Functional assessment approaches:

  • Steady-State Kinetics: Analyzing reaction rates under varying substrate concentrations, pH, temperature, and ionic strength conditions to determine kinetic parameters

  • Stopped-Flow Spectroscopy: Measurement of rapid electron transfer rates on millisecond timescales

  • Oxygen Consumption Analysis: Direct functional outcome of proper cytochrome c:MT-CO2 interaction

Structural characterization:

  • Cross-linking coupled to mass spectrometry: Identification of interaction interfaces

  • Site-directed mutagenesis: Systematic modification of potential interaction residues

  • Computational modeling: Prediction and visualization of binding interfaces

Research on cytochrome c phosphorylation has successfully employed analytical ultracentrifugation and steady-state kinetics to characterize how modifications affect binding with cytochrome c oxidase . Similar methodologies can be applied to study Praomys jacksoni MT-CO2 interactions, potentially revealing species-specific adaptations in this critical electron transfer interface.

How does the molecular evolution of MT-CO2 contribute to understanding mitonuclear coevolution in rodents?

The molecular evolution of MT-CO2 provides a window into the complex dynamics of mitonuclear coevolution, where mitochondrial and nuclear genomes must maintain functional compatibility despite different inheritance patterns and evolutionary rates:

Mitonuclear interactions involving MT-CO2:
MT-CO2 interacts directly with several nuclear-encoded proteins:

  • Other subunits of cytochrome c oxidase

  • Cytochrome c, which transfers electrons to MT-CO2

  • Assembly factors required for complex IV biogenesis

Evolutionary analysis approaches:

  • Comparative sequence analysis across Praomys species and related rodents

  • Identification of coevolving sites between MT-CO2 and interacting nuclear-encoded proteins

  • Assessment of selective pressures on interacting interfaces

  • Dating of adaptive events in mitochondrial versus nuclear lineages

Experimental validation methods:

  • Creation of cybrid cell lines with mismatched mitochondrial and nuclear backgrounds

  • Functional assessment of respiratory efficiency in matched versus mismatched systems

  • Identification of compensatory mutations that restore function in mismatched systems

Research on Tigriopus californicus revealed that certain codons in COII may experience positive selection to compensate for amino acid substitutions in nuclear-encoded interaction partners . This supports the concept that mitonuclear interactions drive molecular evolution in these proteins. Similar patterns in Praomys could reveal how mitonuclear coevolution contributes to speciation or adaptation to different environmental conditions across the genus's range in Africa.

What protein engineering approaches can improve recombinant MT-CO2 stability and yield?

Producing stable, functional recombinant MT-CO2 presents significant challenges due to its complex structure and cofactor requirements. Several protein engineering strategies can enhance yield and stability:

N-terminal modifications:

  • Fusion with solubility-enhancing tags (MBP, SUMO, thioredoxin)

  • Addition of purification tags that minimize interference with protein folding

  • Inclusion of cleavable signal sequences for proper membrane targeting

Core sequence modifications:

  • Codon optimization for expression host (e.g., E. coli, yeast, insect cells)

  • Conservative substitutions at aggregation-prone regions

  • Introduction of disulfide bonds to enhance structural stability

  • Surface charge engineering to improve solubility

C-terminal modifications:

  • Addition of stabilizing structural elements

  • Incorporation of oligomerization domains if beneficial for stability

  • Placement of detection tags that don't interfere with CuA center formation

Expression optimization strategies:

  • Low-temperature induction protocols to facilitate proper folding

  • Co-expression with molecular chaperones or copper chaperones

  • Supplementation of growth media with copper to facilitate metal center formation

  • Dual-plasmid systems for coordinated expression of interacting partners

Research with similar proteins has successfully used the pET-32a vector system with fusion tags for expression and purification . The final construct design should balance yield considerations with the need to maintain native-like structure and function of the CuA active site essential for electron transfer activity.

How can researchers confirm proper folding and metal center assembly in recombinant MT-CO2?

Verifying proper folding and assembly of the critical CuA center in recombinant MT-CO2 requires multiple complementary approaches:

Spectroscopic verification of the CuA center:

  • UV-Visible Spectroscopy: The CuA center has characteristic absorption bands; properly folded MT-CO2 should exhibit the expected spectral signature

  • Circular Dichroism: Provides information on secondary structure elements and can detect major folding abnormalities

  • Electron Paramagnetic Resonance: Offers detailed characterization of the copper center's electronic structure

Structural integrity assessment:

  • Limited Proteolysis: Properly folded proteins show distinct proteolytic patterns compared to misfolded variants

  • Size Exclusion Chromatography: Indicates proper oligomeric state and absence of aggregation

  • Thermal Shift Assays: Measures protein stability and can identify stabilizing conditions

Functional validation:

  • Cytochrome c Oxidation Activity: Direct measurement of electron transfer function

  • Metal Content Analysis: Quantification of copper incorporation using atomic absorption spectroscopy or ICP-MS

  • Interaction Studies: Verification of binding to cytochrome c and other complex IV subunits

Research with recombinant COII has demonstrated that UV-spectrophotometry and infrared spectrometry can effectively confirm that the protein maintains its catalytic capacity to oxidize cytochrome c substrate . These approaches provide critical confirmation that the recombinant protein not only contains the expected structural elements but also maintains functional competence.

What analytical methods best characterize inhibitor interactions with MT-CO2?

Studying interactions between MT-CO2 and potential inhibitors requires a multi-faceted approach combining biophysical, computational, and functional methods:

Inhibitor binding characterization:

  • Surface Plasmon Resonance (SPR): Enables real-time analysis of binding kinetics, determining association and dissociation rates

  • Isothermal Titration Calorimetry (ITC): Provides complete thermodynamic profiles of binding interactions

  • Microscale Thermophoresis: Works with small sample amounts and is compatible with detergent-solubilized membrane proteins

Structural approaches:

  • Molecular Docking: Computational prediction of binding modes and interaction sites, as demonstrated with allyl isothiocyanate binding to COII through hydrogen bonding with specific residues

  • Site-directed Mutagenesis: Experimental validation of predicted binding residues

  • X-ray Crystallography/Cryo-EM: Direct visualization of inhibitor binding, though challenging with membrane proteins

Functional impact assessment:

  • Enzyme Inhibition Kinetics: Determination of IC50 values and inhibition mechanisms

  • Cellular Respiration Assays: Measurement of effects on oxygen consumption in cellular systems

  • Membrane Potential Analysis: Assessment of impacts on proton pumping capability

Research with Sitophilus zeamais COII demonstrated that molecular docking could identify interaction sites for inhibitors like allyl isothiocyanate, which forms a hydrogen bond with specific amino acid residues . This computational approach, validated through functional assays, provides a powerful strategy for characterizing inhibitor interactions with Praomys jacksoni MT-CO2.

What approaches can differentiate between direct effects on MT-CO2 and indirect effects on cytochrome c oxidase complex?

Distinguishing direct effects on MT-CO2 from indirect effects mediated through other components of the cytochrome c oxidase complex requires careful experimental design:

Isolated protein studies:

  • Recombinant MT-CO2 assays: Evaluate effects on the isolated subunit's stability, structure, and metal center

  • Reconstitution experiments: Systematic addition of other subunits to identify which interactions are affected

  • Domain-swapping approaches: Create chimeric proteins to isolate functional domains

Comparative analysis:

  • Cross-species comparisons: Test effects across MT-CO2 from different species with varying sequence characteristics

  • Mutational scanning: Systematic mutation of potential target sites to identify critical residues

  • Isoform comparisons: Where applicable, compare effects across isoforms with different sensitivities

Integrated assessment:

  • Blue Native PAGE: Evaluate effects on complex assembly and stability

  • Respirasome analysis: Determine if effects extend to supercomplexes

  • In vitro versus cellular effects: Compare direct biochemical effects with cellular consequences

Technical approaches:

  • Time-resolved spectroscopy: Can identify which electron transfer steps are affected

  • Site-specific labeling: Strategic introduction of probes at specific locations

  • Accessibility studies: Determine if binding sites become more or less accessible in different contexts

Research methodologies used with cytochrome c oxidase-deficient mutants in yeast provide valuable approaches, including specific staining methods like tetramethyl-p-phenylenediamine that can distinguish cytochrome c oxidase activity from other respiratory functions . Such techniques can help researchers isolate MT-CO2-specific effects from broader impacts on the respiratory chain.

How can evolutionary analysis of MT-CO2 inform functional studies in Praomys jacksoni?

Evolutionary analysis provides critical context for functional studies of Praomys jacksoni MT-CO2, revealing conserved features essential for function versus variable regions that may confer species-specific adaptations:

Evolutionary signatures informing functional analysis:

  • Purifying selection: Regions under strong purifying selection (ω << 1) likely represent functionally critical domains that should be maintained in recombinant constructs

  • Positive selection: Sites with signatures of positive selection (ω > 1) may represent adaptive changes worth investigating through mutagenesis studies

  • Relaxed constraint: Regions evolving under relaxed selective constraint (ω ≈ 1) might tolerate modifications useful for protein engineering

Comparative frameworks:

  • Across Praomys species: Identify genus-specific features

  • Broader murid comparisons: Place Praomys adaptations in rodent evolutionary context

  • Mammalian perspective: Identify deeply conserved features critical for function

Applied evolutionary insights:

  • Target selection for mutagenesis: Prioritize sites showing evolutionary signatures of interest

  • Recombinant construct design: Ensure conservation of critical domains

  • Experimental condition selection: Test function under conditions relevant to the species' ecology

Methodology integration:

  • Calculate evolutionary rates and selection pressures using maximum likelihood models

  • Map evolutionary patterns onto structural models

  • Design functional experiments testing hypotheses generated from evolutionary analysis

Studies of COII in marine copepods revealed that while most sites evolve under strong purifying selection, approximately 4% evolve under relaxed constraint, and some show evidence of positive selection potentially related to compensation for changes in interacting proteins . Similar analysis of Praomys jacksoni MT-CO2 could reveal evolutionary patterns specific to this African rodent lineage, informing functional studies and providing insights into mitochondrial adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.