Recombinant Praomys tullbergi Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Praomys tullbergi (Tullberg's soft-furred rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, involving three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center in subunit 2 and heme A in subunit 1 to the active site (a binuclear center comprising heme A3 and CuB) in subunit 1. Here, oxygen is reduced to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Praomys tullbergi Cytochrome c oxidase subunit 2 (MT-CO2)?

Recombinant Praomys tullbergi Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein derived from Tullberg's soft-furred rat (Praomys tullbergi) that has been expressed in a recombinant system for research purposes. The protein corresponds to subunit 2 of the cytochrome c oxidase complex (Complex IV), a crucial component of the mitochondrial electron transport chain. The full-length protein spans amino acids 1-227 and has been assigned the UniProt identification number Q38RW5 . MT-CO2 plays an essential role in cellular respiration by facilitating the transfer of electrons from cytochrome c to molecular oxygen, contributing to proton pumping across the inner mitochondrial membrane. This recombinant version enables researchers to study the protein's structure, function, and evolutionary significance without needing to isolate it directly from animal tissues.

What are the proper storage and handling recommendations for Recombinant Praomys tullbergi MT-CO2?

For optimal stability and activity retention of Recombinant Praomys tullbergi MT-CO2, researchers should adhere to the following protocol:

  • Store the protein at -20°C for routine use, or at -80°C for extended storage periods

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein's stability

  • Avoid repeated freeze-thaw cycles, as these can significantly reduce protein activity

  • For ongoing experiments, working aliquots can be stored at 4°C for up to one week

  • When handling the protein, maintain aseptic technique and use sterile pipette tips to prevent contamination

  • Before use, gently mix by inversion rather than vortexing to prevent protein denaturation

  • When diluting, use the same buffer composition to maintain protein stability

These recommendations ensure experimental reproducibility and maximize the functional lifespan of the recombinant protein.

What are the alternative names and gene designations for MT-CO2 in Praomys tullbergi?

Researchers should be aware of the multiple nomenclature systems used to refer to this protein and its encoding gene to ensure comprehensive literature searches and appropriate database queries:

Official NameAlternative Protein NamesGene SymbolsDatabase Identifiers
Cytochrome c oxidase subunit 2Cytochrome c oxidase polypeptide IIMT-CO2 (primary)UniProt: Q38RW5
COII
COXII
MTCO2

When searching literature databases or genomic resources, researchers should include all alternative names to ensure comprehensive results. The mitochondrial localization is indicated by the "MT-" prefix in the primary gene symbol, reflecting its encoding in the mitochondrial genome rather than nuclear DNA . This nomenclature consistency is particularly important when comparing orthologous proteins across species or when designing primers for gene amplification.

What experimental approaches are optimal for analyzing the function of Recombinant Praomys tullbergi MT-CO2?

When investigating the functional properties of Recombinant Praomys tullbergi MT-CO2, researchers should consider multiple complementary approaches:

  • Enzyme Activity Assays: Measure cytochrome c oxidase activity using reduced cytochrome c as substrate, monitoring the decrease in absorbance at 550 nm. Key parameters to optimize include:

    • pH (optimal range typically 7.0-7.4)

    • Temperature (rodent proteins often show optimal activity at 37°C)

    • Substrate concentration (typically 10-50 μM reduced cytochrome c)

    • Detergent concentration (0.1-0.5% lauryl maltoside preserves native conformation)

  • Oxygen Consumption Measurements: Using oxygen electrodes or optical sensors to directly measure oxygen reduction rates. This approach provides real-time kinetic data on enzyme function.

  • Reconstitution Studies: Incorporation of purified MT-CO2 into proteoliposomes to assess its contribution to proton pumping and membrane potential generation.

  • Protein-Protein Interaction Analysis: Techniques such as co-immunoprecipitation, surface plasmon resonance, or crosslinking studies to investigate interactions with other subunits of the cytochrome c oxidase complex or with potential regulatory proteins.

  • ROS Production Assessment: Given cytochrome c oxidase's role in reactive oxygen species metabolism, measuring hydrogen peroxide production using fluorescent probes like Amplex Red can provide insights into the protein's contribution to ROS homeostasis .

For comprehensive functional characterization, researchers should apply multiple techniques, as each provides unique insights into different aspects of MT-CO2 function.

How can researchers address potential contamination issues in experiments involving Recombinant Praomys tullbergi MT-CO2?

Contamination can significantly impact experimental outcomes when working with Recombinant Praomys tullbergi MT-CO2. The following methodological approach helps minimize and detect potential contamination:

  • Endotoxin Testing: Regularly assess recombinant protein preparations for endotoxin contamination using the Limulus Amebocyte Lysate (LAL) assay. Endotoxin levels should ideally be below 0.1 EU/μg protein.

  • Microbial Contamination Protocol:

    • Work in a laminar flow hood when handling stock solutions

    • Use sterile-filtered buffers and reagents

    • Implement regular microbial testing of protein stocks

    • Include antimicrobial agents (0.02% sodium azide) for long-term storage

  • Proteolytic Contamination Detection:

    • Perform SDS-PAGE analysis before experiments to verify protein integrity

    • Include protease inhibitor cocktails (PMSF, leupeptin, aprotinin) when handling the protein

    • Conduct activity assays at multiple time points to detect potential degradation

  • Oxidative Damage Prevention:

    • Include reducing agents like DTT (1 mM) or 2-mercaptoethanol to prevent oxidative damage

    • Store proteins in oxygen-depleted environments

    • Monitor for oxidation using spectroscopic methods (absorbance ratio 280/260 nm)

  • Cross-Contamination Prevention:

    • Maintain dedicated pipettes and reagents for recombinant protein work

    • Implement workflow segregation between different protein preparations

    • Use positive and negative controls to detect cross-contamination events

By implementing these measures, researchers can ensure experimental reproducibility and validity when working with Recombinant Praomys tullbergi MT-CO2.

How does Recombinant Praomys tullbergi MT-CO2 contribute to understanding evolutionary relationships among rodent species?

Recombinant Praomys tullbergi MT-CO2 serves as a valuable molecular marker for evolutionary studies due to several key characteristics:

  • Mitochondrial Origin and Evolutionary Rate: MT-CO2, being mitochondrially encoded, exhibits a higher mutation rate than nuclear genes but is under strong functional constraints. This makes it particularly useful for resolving phylogenetic relationships at the genus and species levels within rodents.

  • Sequence Conservation Analysis: Comparative sequence analysis of MT-CO2 across different rodent species reveals patterns of:

    • Highly conserved functional domains (electron transfer sites)

    • Variable regions that reflect evolutionary divergence

    • Signatures of selective pressure on specific residues

  • Methodological Approach for Phylogenetic Studies:

    • Extract complete MT-CO2 sequences from multiple rodent species

    • Perform multiple sequence alignment using MUSCLE or CLUSTAL

    • Apply maximum likelihood and Bayesian inference methods for tree construction

    • Implement molecular clock analyses to estimate divergence times

    • Test alternative evolutionary models using likelihood ratio tests

  • Case Study - Murine Relationships:
    When analyzing Praomys tullbergi in relation to other rodents, researchers typically observe:

    Species ComparisonSequence Identity (%)Estimated Divergence Time (MYA)
    P. tullbergi vs. Rattus norvegicus82-85%9.7-11.2
    P. tullbergi vs. Mus musculus80-83%10.4-12.3
    P. tullbergi vs. Other Praomys species92-98%1.8-4.5
  • Biogeographical Implications: MT-CO2 sequence data from Praomys tullbergi has helped resolve distribution patterns and migration histories of African murids, particularly in relation to climate change events in the Albertine Rift region of Africa .

By expressing recombinant versions of MT-CO2 from different species, researchers can combine evolutionary sequence analysis with functional studies to understand how molecular changes correlate with adaptation to different environmental conditions.

What roles does cytochrome c oxidase play in ROS homeostasis and how can this be studied using Recombinant Praomys tullbergi MT-CO2?

Cytochrome c oxidase plays a critical role in reactive oxygen species (ROS) homeostasis through several mechanisms that can be investigated using Recombinant Praomys tullbergi MT-CO2:

  • Dual Role in ROS Metabolism:

    • As the terminal electron acceptor in the respiratory chain, efficient cytochrome c oxidase activity prevents electron leakage at upstream complexes, thereby reducing ROS production

    • Under certain conditions, cytochrome c oxidase itself can produce ROS through side reactions

  • Experimental Approaches for ROS Studies with Recombinant MT-CO2:

    • Measure H₂O₂ production rates using fluorescent probes (Amplex Red, DCFDA)

    • Assess superoxide generation using lucigenin or MitoSOX Red

    • Quantify antioxidant enzyme activities in response to altered MT-CO2 expression

    • Implement oxygen consumption rate (OCR) measurements in parallel with ROS detection

  • Interaction with Cytochrome c-Peroxidase:
    Cytochrome c-peroxidase (CCP) interacts functionally with the cytochrome c oxidase system by:

    • Utilizing H₂O₂ as an electron acceptor to oxidize ferrocytochrome c

    • Contributing to intracellular ROS homeostasis

    • Potentially modulating signaling pathways involved in cellular responses

  • Protocol for Assessing MT-CO2 Impact on ROS Homeostasis:

    1. Express recombinant MT-CO2 in model cell systems

    2. Measure basal and stress-induced ROS levels

    3. Quantify oxidative damage markers (protein carbonylation, lipid peroxidation)

    4. Assess mitochondrial membrane potential using JC-1 or TMRM

    5. Monitor expression changes in ROS-responsive genes

  • Role in Cellular Adaptation to Oxidative Stress:
    Data from fungal models suggest that cytochrome c-related proteins, including cytochrome c oxidase, participate in adaptation to H₂O₂ toxicity , which can be tested in mammalian systems using the recombinant Praomys tullbergi MT-CO2 to determine if similar mechanisms exist in rodents.

By investigating these aspects, researchers can gain insights into how MT-CO2 contributes to cellular responses to oxidative challenges and how these mechanisms might have evolved in different rodent species.

What methodological considerations are important when designing antibodies against Recombinant Praomys tullbergi MT-CO2?

Designing effective antibodies against Recombinant Praomys tullbergi MT-CO2 requires careful methodological planning:

  • Epitope Selection Strategy:

    • Analyze the complete 227-amino acid sequence to identify antigenic regions

    • Prioritize segments with high surface probability and hydrophilicity

    • Avoid transmembrane domains (typically hydrophobic regions)

    • Consider the following regions based on predictive algorithms:

      • N-terminal region (amino acids 25-40)

      • Loop regions (amino acids 80-95 and 150-165)

      • C-terminal domain (amino acids 205-220)

  • Cross-Reactivity Considerations:

    • Examine sequence alignment with related species to identify:

      • Praomys-specific epitopes (for species-specific detection)

      • Conserved epitopes (for broad rodent reactivity)

    • Perform BLAST searches to predict potential cross-reactivity

    • Include negative control tissues/proteins in validation studies

  • Antibody Format Selection:

    Antibody TypeAdvantagesBest Applications
    PolyclonalMultiple epitope recognition, Robust signalWestern blotting, Immunoprecipitation
    MonoclonalHigh specificity, Batch consistencyImmunohistochemistry, Flow cytometry
    Recombinant antibodiesDefined sequence, ReproducibilityAll applications, Especially quantitative assays
  • Validation Protocol Design:

    • Western blot against purified recombinant protein

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with appropriate positive/negative controls

    • Peptide competition assays to confirm specificity

    • Knockout/knockdown validation when possible

  • Application-Specific Optimization:

    • For Western blotting: Optimize denaturation conditions, consider native vs. reduced states

    • For immunohistochemistry: Test multiple fixation methods (formalin, Bouin's, etc.)

    • For ELISA: Determine optimal coating concentration and blocking agents

    • For immunoprecipitation: Test different lysis buffers and detergent concentrations

By systematically addressing these methodological considerations, researchers can develop specific and sensitive antibodies against Recombinant Praomys tullbergi MT-CO2 that are suitable for their particular experimental applications.

How can researchers interpret contradictory data when studying mitochondrial function using Recombinant Praomys tullbergi MT-CO2?

When encountering contradictory results in studies involving Recombinant Praomys tullbergi MT-CO2, researchers should implement the following systematic troubleshooting approach:

  • Source of Contradictions Analysis Framework:

    • Reagent variability: Different protein batches, buffer compositions, or storage conditions

    • Methodological differences: Variations in assay conditions, detection methods, or data normalization

    • Biological complexity: Interaction with different cellular components or regulatory mechanisms

    • Data interpretation: Statistical approaches, outlier handling, or threshold definitions

  • Methodological Reconciliation Strategy:

    • Perform side-by-side comparisons using standardized protocols

    • Implement multiple orthogonal techniques to assess the same parameter

    • Develop internal controls and reference standards for each experiment

    • Document all experimental conditions in exceptional detail

  • Common Sources of Artifacts and Solutions:

    Source of ArtifactDetection MethodResolution Strategy
    Protein aggregationDynamic light scatteringOptimize buffer conditions, add stabilizers
    Oxidative damageSpectroscopic analysisInclude reducing agents, minimize freeze-thaw
    Incomplete reconstitutionActivity measurementsStandardize reconstitution protocols
    Interaction with detergentsDetergent screeningTest multiple detergent types and concentrations
    Cofactor depletionMetal content analysisSupplement with required cofactors
  • Integrative Data Analysis Approach:

    • Implement multivariate statistical methods to identify patterns across datasets

    • Develop mathematical models to predict experimental outcomes under different conditions

    • Compare results with computational predictions based on protein structure

    • Consider species-specific factors when comparing to data from other organisms

  • Case Study: Resolving Contradictory Activity Measurements
    When different laboratories report varying cytochrome c oxidase activity levels:

    • Standardize enzyme concentration measurements (BCA vs. Bradford vs. spectroscopic)

    • Normalize activity to heme a content rather than total protein

    • Account for temperature-dependent kinetic differences (Q10 effect)

    • Consider the impact of lipid environment on enzyme activity

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more coherent understanding of MT-CO2 function across different experimental contexts.

How can Recombinant Praomys tullbergi MT-CO2 be used as a biomarker for environmental stress studies?

Recombinant Praomys tullbergi MT-CO2 can serve as a valuable biomarker for environmental stress studies through several methodological approaches:

  • Climate Change Impact Assessment:

    • Praomys tullbergi, native to African regions experiencing significant climate shifts, has evolved mechanisms to adapt to environmental stressors

    • The MT-CO2 protein can be used to study mitochondrial responses to temperature fluctuations and oxidative challenges associated with climate change

    • Comparative studies between populations from different climate zones can reveal adaptive variations in MT-CO2 function

  • Biomonitoring Protocol Development:

    • Develop antibodies against specific epitopes of Praomys tullbergi MT-CO2

    • Establish baseline expression and activity levels in control populations

    • Monitor changes in MT-CO2 expression, post-translational modifications, and activity in response to:

      • Temperature extremes

      • Hypoxic conditions

      • Exposure to environmental pollutants

      • Nutritional stress

  • Experimental Design for Environmental Stress Studies:

    • In vitro exposure of recombinant MT-CO2 to environmental stressors

    • Ex vivo tissue studies comparing MT-CO2 from stressed and control animals

    • In vivo monitoring of MT-CO2 modifications in sentinel populations

    • Correlation of MT-CO2 alterations with physiological parameters and population-level effects

  • Vulnerability Assessment Applications:
    The Albertine Rift region in Africa, home to various Praomys species, has been identified as highly vulnerable to climate change impacts . Using MT-CO2 as a biomarker can help:

    • Identify populations at heightened risk

    • Evaluate potential adaptation mechanisms

    • Develop early warning indicators of population stress

    • Guide conservation strategies for vulnerable species

  • Methodological Considerations for Field Applications:

    • Develop field-portable assays for MT-CO2 activity measurement

    • Establish non-invasive sampling techniques where possible

    • Incorporate MT-CO2 biomarkers into broader ecological monitoring programs

    • Calibrate MT-CO2 responses against established ecosystem health indicators

By implementing these approaches, researchers can utilize Recombinant Praomys tullbergi MT-CO2 as both a research tool and a biomarker for understanding and monitoring the impacts of environmental change on mammalian species.

What are the molecular mechanisms of MT-CO2 adaptation to varying CO2 levels, and how can Recombinant Praomys tullbergi MT-CO2 illuminate these processes?

The relationship between atmospheric CO2 levels and mitochondrial MT-CO2 function represents an important but understudied area of research. Recombinant Praomys tullbergi MT-CO2 provides an excellent model system for investigating these molecular adaptation mechanisms:

  • CO2 Sensing and Response Pathways:

    • While MT-CO2 (Cytochrome c oxidase subunit 2) does not directly sense CO2 levels, it functions within respiratory complexes that are regulated in response to environmental CO2 changes

    • Elevated CO2 levels affect cellular pH, which in turn modulates cytochrome c oxidase activity

    • Recombinant MT-CO2 can be used in controlled experimental systems to measure activity changes under varying CO2 concentrations

  • Experimental Protocol for CO2 Response Studies:

    • Express Recombinant Praomys tullbergi MT-CO2 in appropriate experimental systems

    • Measure enzyme kinetics under precisely controlled CO2 concentrations (ranging from pre-industrial levels of ~280 ppm to projected future levels >500 ppm)

    • Assess post-translational modifications (phosphorylation, acetylation) occurring in response to CO2 variation

    • Identify interaction partners that mediate CO2-responsive regulation

  • Comparative Analysis Across Climate Gradients:

    • Praomys species inhabit diverse African habitats with varying CO2 microenvironments

    • MT-CO2 variants from populations across these gradients can be expressed recombinantly and compared

    • Functional differences may reveal evolutionary adaptations to local CO2 conditions

  • Data from CO2 Monitoring Networks and Modeling:
    The WMO Global Atmosphere Watch (GAW) and other monitoring networks provide detailed CO2 concentration data that can be incorporated into experimental designs:

    Time PeriodGlobal Mean Surface CO2 (ppm)Annual Growth Rate (ppm/year)
    Pre-industrial~280~0
    1980s~350~1.5
    Current~410~2.4
    Projected 2050~500-600Varies by scenario
  • Translational Applications:

    • Insights from MT-CO2 adaptations in Praomys could inform:

      • Predictions about mammalian adaptation to changing atmospheric composition

      • Development of biomarkers for mitochondrial stress under elevated CO2

      • Design of interventions to protect vulnerable species from climate change impacts

      • Understanding of evolutionary mechanisms that enable adaptation to changing environments

This research direction bridges molecular biology with climate science, offering insights into how fundamental cellular processes respond to global environmental changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.