Recombinant Preprotein translocase subunit SecE (secE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
secE; STY3738; t3480; Protein translocase subunit SecE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella typhi
Target Names
secE
Target Protein Sequence
MSANTEAQGSGRGLEAMKWIVVAILLIVAIVGNYLYRDMMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF
Uniprot No.

Target Background

Function

SecE is an essential subunit of the SecYEG protein translocation channel. It functions to clamp together the two halves of SecY and may interact with the channel plug during protein translocation.

Database Links

KEGG: stt:t3480

STRING: 220341.STY3738

Protein Families
SecE/SEC61-gamma family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is SecE and what is its functional role in protein translocation?

SecE is an essential subunit of the heterotrimeric integral membrane protein complex (SecYEG) that constitutes the core of the bacterial preprotein translocase. In Escherichia coli, SecE works in conjunction with SecY and SecG to form a channel through which preproteins are transported across the cytoplasmic membrane. The SecYEG complex interacts with the peripheral membrane ATPase SecA to facilitate this process. SecE plays a critical stabilizing role for the translocase complex, as demonstrated by the observation that the stability of overexpressed SecY is dependent upon co-overexpression of SecE, suggesting a direct interaction between these subunits .

Within the translocase complex, SecE helps maintain the structural integrity of the translocation channel. While SecY and SecA are directly involved in preprotein translocation and can be cross-linked to translocating preproteins, SecE appears to have a more structural role in maintaining the proper conformation of the complex . The interaction between SecY and SecE is particularly important, with specific points of contact identified between their transmembrane domains .

How does SecE interact with other components of the translocase machinery?

SecE forms a stable heterotrimeric complex with SecY and SecG. Biochemical studies have demonstrated direct interactions between these three subunits through co-chromatography and co-immunoprecipitation techniques . The association between SecY and SecE is particularly strong and important for function. Contact points between the transmembrane domains of SecY and SecE have been mapped through various studies .

What are the essential experimental techniques for studying SecE function?

Several experimental approaches have proven valuable for studying SecE function:

  • Cross-linking studies: Formaldehyde or other cross-linking agents can be used to identify proteins that interact with SecE in vivo. These experiments have been instrumental in determining which components of the translocase are in close proximity during translocation .

  • Co-immunoprecipitation: This technique allows researchers to identify stable protein-protein interactions. For example, anti-HA immunoprecipitation of tagged SecE (SecE-HA) can be used to study its interactions with other translocase components .

  • Genetic studies: Creating mutations in the secE gene and observing their effects on protein translocation can provide insights into the functional domains of SecE. The prl mutants have been particularly informative in understanding the role of SecE in the translocase complex .

  • Reconstitution experiments: Purified SecYEG can be reconstituted into proteoliposomes to study translocation in a controlled environment, allowing researchers to determine the minimal components required for function .

  • Protein purification and stability assays: Co-expression studies examining the stability of SecY in the presence or absence of SecE have demonstrated the importance of their interaction .

What experimental approaches are most effective for expressing and purifying recombinant SecE?

For expressing and purifying recombinant SecE, researchers typically employ the following methods:

Expression Systems:

  • E. coli-based expression: SecE is often co-expressed with SecY and SecG to ensure proper folding and stability. Overexpression of SecE alone may result in poor yields due to its hydrophobic nature and tendency to aggregate.

  • Tagging strategies: Addition of affinity tags such as hexahistidine (His6) tags or hemagglutinin (HA) tags facilitates purification. Research shows that C-terminal tags are often preferable as they tend to interfere less with function .

Purification Protocol:

  • Membrane isolation from expression cells

  • Detergent solubilization (typically using mild detergents like DDM or digitonin)

  • Affinity chromatography utilizing the engineered tag

  • Size exclusion chromatography to ensure purity and proper complex formation

It's important to note that SecE should ideally be purified as part of the SecYEG complex rather than in isolation, as isolated SecE may not maintain its native conformation. When co-expressed with SecY and SecG, the complex shows greater stability and functionality in subsequent assays .

How do researchers investigate the oligomeric state of SecE during translocation?

The oligomeric state of SecE during translocation remains a topic of active research. Several complementary approaches have been used to study this:

  • Cross-linking studies: Formaldehyde cross-linking of translocase reveals cross-links between SecY, SecE, and SecG, but higher-order oligomers are not consistently observed . This suggests that the active form might be monomeric.

  • Tagged protein analysis: Studies using hemagglutinin-tagged SecE (SecE-HA) alongside unmodified SecE have been used to investigate potential oligomerization. When membranes containing similar amounts of SecE and SecE-HA were solubilized and immunoprecipitated with anti-HA antibodies, untagged SecE was not present in the immunoprecipitates, suggesting that multiple copies of SecE do not associate in functional translocation complexes .

  • Translocation intermediate analysis: Membranes containing SecE and SecE-HA can be saturated with translocation intermediates and then solubilized. Anti-HA immunoprecipitation of these complexes reveals that untagged SecE is not present, again suggesting that translocation intermediates are not engaged with multiple copies of SecYEG .

Table 1: Evidence for Monomeric vs Oligomeric SecYEG Complex

Experimental ApproachEvidence for Monomeric StateEvidence for Oligomeric State
Formaldehyde cross-linkingShows cross-links between SecY, SecE, and SecG but not higher-order oligomers -
HA-tagged immunoprecipitationAnti-HA immunoprecipitates lack untagged SecE or SecY cross-linked to SecE -
Translocation intermediate analysisTranslocation complexes contain more moles of preprotein intermediate than untagged subunit -
Electron microscopy-Shows ring-like structures of purified complexes

The preponderance of biochemical evidence currently suggests that the active form of preprotein translocase is likely monomeric SecYEG, though structural studies have sometimes indicated ring-like oligomeric arrangements .

What role does SecE play in maintaining the integrity of the SecYEG complex?

SecE plays a crucial role in maintaining the integrity and stability of the SecYEG complex. Several lines of evidence highlight this role:

  • SecY stabilization: In vivo studies have demonstrated that the stability of overexpressed SecY is dependent upon the co-overexpression of SecE, indicating that SecE directly protects SecY from degradation .

  • Complex assembly: SecE appears to be essential for the proper assembly of the SecYEG complex. Without SecE, SecY cannot form a functional translocase .

  • Structural rigidity and flexibility: SecE provides structural support to the complex while maintaining necessary flexibility for function. Studies of prl mutants show that the lability of association between these subunits is important for translocase function .

  • Prevention of SecY aggregation: SecE may prevent the aggregation and denaturation of SecY, which is particularly important during the dynamic conformational changes that occur during protein translocation.

Despite its essential role in maintaining complex integrity, cross-linking studies suggest that SecE may not directly contact the translocating preprotein. When photoactivable cross-linkers were attached to preproteins and used to identify neighboring proteins during translocation, radiolabeled cross-linker was recovered with SecA and SecY but not with SecE . This suggests SecE's primary role may be structural rather than directly participating in the translocation channel.

What contradictions exist in the literature regarding SecE function and structure?

The literature contains several notable contradictions regarding SecE function and structure:

These contradictions highlight the complexity of the protein translocation process and the challenges in studying membrane protein complexes. They also point to potential areas where further research could provide important clarification.

What advanced cross-linking methodologies are most effective for studying SecE interactions?

Several advanced cross-linking methodologies have proven effective for studying SecE interactions:

  • Formaldehyde cross-linking in vivo: This approach has been successfully used to identify proteins associated with SecA in intact cells, revealing specific cross-linking between SecA and SecY . This method preserves the native environment of the translocase complex.

  • Site-specific photo-cross-linking: By introducing unique cysteinyl residues at specific positions and attaching photoactivable cross-linkers, researchers can map the environment of specific regions of interest. This approach has been used to study the environment of preproteins during translocation .

  • Reducible cross-linkers: Cross-linkers containing disulfide bonds allow for the selective recovery of cross-linked products. For example, a photoactivable, radiolabeled, and reducible cross-linker attached to preproteins enabled researchers to identify SecA and SecY as the primary proteins contacting translocating chains .

  • Sequential cross-linking and immunoprecipitation: By combining cross-linking with immunoprecipitation using tagged proteins (e.g., SecE-HA), researchers can investigate the composition of specific complexes. This approach has been used to show that translocation intermediates are not engaged with multiple copies of SecYEG .

Table 2: Comparison of Cross-linking Methods for Studying SecE Interactions

Cross-linking MethodAdvantagesLimitationsKey Findings
Formaldehyde in vivoPreserves native interactions; Simple procedureLimited specificity; Cannot target specific residuesRevealed SecA-SecY interaction in vivo
Site-specific photo-cross-linkingHigh spatial resolution; Can target specific domainsRequires mutation and protein modificationIdentified proteins in proximity to translocating chains
Reducible cross-linkersAllows selective recovery of cross-linked productsComplex chemistry; May introduce artifactsShowed SecA and SecY are primary contacts for preproteins
Combined with immunoprecipitationCan distinguish between different complexesRequires tagged proteins; May miss transient interactionsSuggested monomeric SecYEG is active in translocation

How do post-translational modifications affect SecE function in different organisms?

While the search results don't provide specific information about post-translational modifications of SecE, this represents an important area for research. Based on general knowledge of membrane protein biology, several types of modifications might affect SecE function:

  • Phosphorylation: Phosphorylation of cytoplasmic domains could regulate SecE interactions with other translocase components or modulate its activity during different cellular states.

  • Lipid modifications: Acylation or other lipid modifications could affect SecE membrane positioning and dynamics.

  • Organism-specific variations: Different organisms show variations in SecE structure and potential modification sites. For example, mycobacterial SecE might have different modification patterns compared to E. coli SecE, potentially reflecting adaptations to different membrane compositions or secretion requirements.

Future research directions in this area could include:

  • Proteomic analysis to identify and map post-translational modifications of SecE across species

  • Mutational studies to determine the functional consequences of abolishing or mimicking specific modifications

  • Temporal studies to understand if SecE modifications change in response to stress or different growth conditions

What methodological approaches best address the challenge of studying SecE in its native membrane environment?

Studying SecE in its native membrane environment presents significant challenges due to the complexity of membrane protein biochemistry. Several methodological approaches have proven valuable:

  • In vivo cross-linking: Formaldehyde treatment of intact cells preserves the native interactions of SecE with other translocase components, providing insights into the physiological state of the complex . This approach revealed specific cross-linking between SecA and SecY in vivo.

  • Translocation intermediate trapping: By using preproteins fused to domains that cannot be translocated (e.g., dihydrofolate reductase), researchers can create stable translocation intermediates to study the environment of the translocation channel . This approach showed that SecA and SecY are the primary proteins contacting translocating chains.

  • Genetic approaches with conditional mutants: Temperature-sensitive or other conditional secE mutants allow researchers to study the consequences of SecE dysfunction in vivo without the need for purification and reconstitution.

  • Advanced microscopy techniques: Super-resolution microscopy and single-particle tracking can provide insights into the dynamics and localization of SecE in living cells.

  • Single-case experimental designs (SCEDs): These designs, while not specifically mentioned in relation to SecE, can be valuable for studying phenomena with high variability or in systems where obtaining homogeneous samples is difficult . This approach might be adapted to study SecE function in different cellular contexts.

The combination of these approaches provides complementary information about SecE structure and function in its native environment, overcoming the limitations of any single method.

What are the most significant technical challenges in recombinant SecE expression and purification?

Recombinant SecE expression and purification face several significant technical challenges:

  • Membrane protein solubility: As an integral membrane protein, SecE is highly hydrophobic and tends to aggregate when removed from its membrane environment. This creates difficulties during extraction and purification steps.

  • Maintaining native conformation: Ensuring that purified SecE maintains its native structure is challenging. The protein may adopt non-native conformations during solubilization and purification, potentially affecting functional studies.

  • Complex stability: SecE forms a heterotrimeric complex with SecY and SecG, and individual subunits may be unstable when expressed alone. This necessitates co-expression strategies, which add complexity to the purification process.

  • Detergent selection: Finding a detergent that effectively solubilizes SecE while preserving its native structure and function requires extensive optimization. Different detergents may affect SecE stability and activity in unpredictable ways.

  • Expression toxicity: Overexpression of membrane proteins like SecE can be toxic to host cells, limiting the achievable yield and requiring careful optimization of expression conditions.

These challenges necessitate specialized approaches, including co-expression with other translocase components, careful detergent selection, and the use of tags that facilitate purification without compromising function.

How does the structure-function relationship of SecE inform translocation mechanism models?

The structure-function relationship of SecE provides important insights into translocation mechanism models:

  • Channel architecture: While SecE may not directly contact translocating preproteins , it plays a crucial role in maintaining the structural integrity of the translocation channel. Its interaction with SecY is particularly important for channel stability and function.

  • Oligomeric state: Evidence suggests that the active form of preprotein translocase is monomeric SecYEG rather than oligomeric . This challenges models proposing that a ring of SecYEG complexes forms the translocation pore.

  • Dynamic associations: The association between SecY and SecE must maintain some degree of flexibility for proper function. Studies of prl mutants show that a certain lability in this interaction is important for translocase activity .

  • Preprotein pathway: Cross-linking studies suggest that SecY and SecA form the primary contacts with translocating preproteins, with SecE playing a more indirect role . This supports models where the preprotein passes through a channel primarily formed by SecY, with SecA driving the translocation process.

  • Lateral release mechanism: The relationship between SecE and SecY may influence how hydrophobic segments of membrane proteins are laterally released from the translocase into the lipid bilayer. The preprotein chain can slide forward and back in the translocase when not bound by SecA and can be released laterally at sites of even limited hydrophobicity .

These structure-function insights have refined our understanding of protein translocation, shifting from models proposing large oligomeric pores to more dynamic models involving monomeric translocase units.

What emerging technologies might advance our understanding of SecE function?

Several emerging technologies hold promise for advancing our understanding of SecE function:

  • Cryo-electron microscopy (cryo-EM): High-resolution cryo-EM has revolutionized membrane protein structural biology and could provide detailed insights into SecE structure within the translocase complex, particularly during different stages of the translocation process.

  • Single-molecule techniques: Methods such as single-molecule FRET (Förster Resonance Energy Transfer) can track conformational changes in SecE during protein translocation in real-time, providing dynamic information not accessible through static structural approaches.

  • Nanodiscs and other membrane mimetics: Advanced membrane mimetics can provide more native-like environments for studying SecE function compared to detergent micelles, potentially resolving contradictions in the literature regarding oligomeric state and function.

  • Integrative structural biology: Combining multiple structural techniques (X-ray crystallography, NMR, cryo-EM) with computational modeling could provide a more comprehensive view of SecE structure and dynamics.

  • Advanced cross-linking approaches: Development of newer, more specific cross-linking methodologies with improved spatial and temporal resolution could further clarify the interactions between SecE and other translocase components during different stages of translocation.

  • CRISPR-Cas9 genome editing: This technology enables precise manipulation of the secE gene in its native context, allowing for detailed functional studies of specific domains or residues without the complications of overexpression systems.

These technologies, particularly when used in combination, have the potential to resolve current contradictions in the literature and provide a more complete understanding of SecE function in protein translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.