Recombinant Presbytis comata Melanocyte-stimulating hormone receptor (MC1R)

What is the molecular structure of Presbytis comata MC1R?

Presbytis comata (Grizzled leaf monkey) MC1R is a 317 amino acid G protein-coupled receptor. Its full amino acid sequence is: MPVQGSQRRLLGSLNSTPTATPKLGLAANQTGAQCLEVSIPDGLFLSLGLVSLVENVLVVAAIARRNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAAVVQQLDNVIDVITCSSMLSSLCFLGAIAMDRRYISIFYALRYHSIVTLPRARGVVAAIWVASILFSTLFIAYYDDHVAVLLCLVVFFLAMLVLMAVLYVHMLARARACQHAQGIAQHLHKRQRPAHQGVGLKGAATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAFRSQELRRTLKKVLLCSW . The protein contains seven transmembrane domains characteristic of G protein-coupled receptors, with sequence similarities to other primate MC1R proteins, notably Trachypithecus cristatus (Silvered leaf-monkey) .

How does recombinant Presbytis comata MC1R differ from other primate MC1R proteins?

While maintaining the core structural elements of the MC1R family, sequence analysis reveals specific variations in the N-terminal domain and third intracellular loop regions compared to other primates. The Presbytis comata MC1R shows high sequence homology with Trachypithecus cristatus MC1R (Q864I6), though with distinctive variations in amino acid residues, particularly in positions affecting ligand binding specificity . These differences provide valuable insights for comparative studies investigating the evolution of melanocortin signaling across primate lineages.

What are the optimal storage conditions for recombinant Presbytis comata MC1R protein?

For long-term stability, recombinant Presbytis comata MC1R should be stored at -20°C in a buffer containing 50% glycerol. Working aliquots can be maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided to maintain protein integrity and function . For reconstitution, it is recommended to briefly centrifuge the protein vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, similar to protocols used for related recombinant proteins .

How can recombinant Presbytis comata MC1R be used to study the evolution of pigmentation pathways?

Recombinant Presbytis comata MC1R serves as a valuable tool for investigating evolutionary adaptations in primate pigmentation. Researchers can employ comparative functional assays with MC1R variants from different primate species to assess differential responses to melanocortin peptides. The Presbytis comata MC1R can be used in cAMP signaling assays, as MC1R activation typically induces cAMP production through adenylyl cyclase stimulation . By comparing signaling efficacies between Presbytis comata and other primate MC1Rs, including human variants, researchers can identify key evolutionary adaptations in the melanocortin system across primate lineages.

What is the role of MC1R in UV-induced DNA damage protection, and how can recombinant Presbytis comata MC1R inform this research?

MC1R plays a critical protective role in UV-induced chromosomal stability and centromere integrity. Studies have demonstrated that α-MSH/MC1R protects melanocytes from accumulating UV-induced chromosome aberrations, with a specifically high level of protection against centromeric fragmentations . This protection is palmitoylation-dependent. Recombinant Presbytis comata MC1R can be used in comparative studies to investigate whether this protective mechanism is conserved across primate species and whether specific structural differences affect the efficiency of UV protection. Such research could utilize metaphase spread chromosome analysis following UV irradiation in cellular models expressing the recombinant receptor .

How do variants in MC1R affect its function, and what methodologies can be used to identify functional consequences of Presbytis comata MC1R polymorphisms?

Human MC1R variants have been extensively studied, with several variants classified as either high penetrance (R) or low penetrance (r) based on their functional effects. The following table summarizes key human MC1R variants and their effects:

To identify and characterize potential polymorphisms in Presbytis comata MC1R, researchers could employ several approaches:

• Genomic sequencing of multiple individuals to identify naturally occurring variants

• Site-directed mutagenesis of recombinant MC1R to assess functional consequences

• cAMP signaling assays to determine effects on downstream signaling

• Cell surface expression studies to assess receptor trafficking

• Comparative analysis with known human variants to predict functional outcomes

What are the optimal expression systems for producing functional recombinant Presbytis comata MC1R?

While E. coli expression systems have been used successfully for producing recombinant MC1R proteins , membrane proteins often require eukaryotic expression systems for proper folding and post-translational modifications. For functional studies of Presbytis comata MC1R, mammalian expression systems (HEK293, CHO cells) are recommended as they provide appropriate cellular machinery for receptor glycosylation and trafficking to the plasma membrane. Insect cell systems (Sf9, Hi5) using baculovirus vectors represent an alternative that balances protein yield with post-translational modification capabilities. When designing expression constructs, consideration should be given to purification tags (His, FLAG) that minimally impact receptor function, with placement at either N- or C-terminus depending on functional requirements .

What assays can be used to evaluate the functional activity of recombinant Presbytis comata MC1R?

Several complementary approaches can be employed to assess recombinant MC1R functionality:

• cAMP Accumulation Assays: Using either radioimmunoassay or ELISA-based detection methods to measure intracellular cAMP levels following receptor stimulation with α-MSH or other melanocortin peptides.

• ERK1/2 Phosphorylation: Western blot analysis to detect activation of the MAPK pathway downstream of MC1R activation.

• Calcium Mobilization Assays: Fluorescence-based methods using calcium-sensitive dyes to detect MC1R-mediated calcium signaling.

• Receptor Binding Assays: Using radiolabeled or fluorescently labeled ligands to determine binding affinity and specificity.

• Palmitoylation Assays: Given the importance of palmitoylation for MC1R function, particularly in UV protection, acyl-biotin exchange (ABE) or click chemistry approaches can be used to assess receptor palmitoylation status .

How can recombinant Presbytis comata MC1R be used in developing imaging agents for melanoma research?

MC1R has emerged as a promising target for melanoma imaging and therapy. Clinical studies have investigated MC1R-targeted imaging tracers such as [203Pb]VMT01 and [68Ga]VMT02 for SPECT/CT and PET/CT imaging, respectively . Recombinant Presbytis comata MC1R can serve as a valuable tool in the preclinical development of new imaging agents through:

• In vitro binding assays to assess the affinity and specificity of candidate imaging agents

• Competition assays to evaluate binding site interactions

• Structure-activity relationship studies to optimize tracer design

• Comparative studies with human MC1R variants to predict clinical translation potential

For imaging agent development, [68Ga]VMT02 PET/CT at 3 hours post-injection has shown optimal tumor-to-background ratio, while [203Pb]VMT01 SPECT/CT demonstrated tumor retention at 24 hours . These parameters can guide experimental design when evaluating novel tracers using recombinant MC1R systems.

How do MC1R variants in primates like Presbytis comata inform our understanding of human melanoma susceptibility?

Studies in human populations have established MC1R as a key genetic determinant in melanoma susceptibility. Particularly, MC1R variants affect childhood and adolescent melanoma risk, with r variants showing higher prevalence in young melanoma patients compared to adult patients (OR 1.54, 95% CI 1.02–2.33) . Comparative analysis of Presbytis comata MC1R with human MC1R can provide evolutionary insights into conserved regions critical for skin cancer protection. Research approaches could include:

• Sequence alignment to identify conserved domains between primate and human MC1R

• Functional comparison of UV-protective mechanisms

• Analysis of signaling pathway conservation

• Investigation of melanin synthesis regulation across species

Such comparative studies may reveal evolutionary adaptations in MC1R function that could inform novel therapeutic approaches for melanoma prevention or treatment .

What mechanisms account for the protective role of MC1R in chromosome stability, and how might these differ between human and Presbytis comata MC1R?

MC1R plays a critical role in protecting melanocytes from UV-induced chromosomal aberrations and maintaining centromere integrity through palmitoylation-dependent mechanisms . Research has demonstrated that MC1R depletion leads to increased lagging chromosomes and anaphase bridges during anaphase in division cells following UV radiation. The transcription factor Mitf has been identified as a mediator in this process, as Mitf overexpression can rescue UV-induced cytogenetic alterations in human primary melanocytes with MC1R silencing .

To investigate potential differences between human and Presbytis comata MC1R in chromosome protection:

• Compare palmitoylation sites and efficiency between species

• Assess differential responses to UV radiation using metaphase spread chromosome analysis

• Evaluate species-specific interactions with Mitf and other downstream effectors

• Analyze centromere fragmentation patterns following UV exposure in cells expressing either human or Presbytis comata MC1R

These studies could reveal evolutionary adaptations in UV protection mechanisms across primate species, potentially identifying novel protective pathways that could be therapeutically exploited .

What are common challenges in expressing and purifying functional recombinant Presbytis comata MC1R, and how can they be addressed?

Membrane proteins like MC1R present several challenges during recombinant expression and purification. Common issues include:

• Low expression levels: Optimize codon usage for the expression host, consider using stronger promoters, and test different cell lines or expression conditions.

• Protein misfolding: Employ chaperone co-expression strategies, optimize growth temperature (often lower temperatures improve folding), and consider fusion partners that enhance solubility.

• Aggregation during purification: Use appropriate detergents for solubilization (mild non-ionic detergents like DDM or LMNG), include glycerol in buffers, and optimize purification temperatures.

• Loss of function after purification: Consider using stabilizing ligands during purification, employ lipid reconstitution approaches, or use nanodiscs or other membrane mimetics to maintain native-like environment.

• Post-translational modification heterogeneity: Select expression systems capable of proper modifications (particularly palmitoylation), and consider site-directed mutagenesis to eliminate problematic modification sites if necessary .

How can researchers reconcile conflicting data between in vitro and in vivo studies of MC1R function?

Discrepancies between in vitro and in vivo MC1R functional studies are common and may arise from several factors:

• Complex signaling environment: In vivo, MC1R functions within a complex signaling network influenced by hormones, cytokines, and neighboring cells. To address this, employ co-culture systems or 3D culture models that better recapitulate the in vivo microenvironment.

• Differential expression of signaling partners: Expression levels of G proteins, arrestins, and other signaling partners may differ between in vitro systems and in vivo contexts. Consider characterizing the expression profile of key signaling partners and reconstituting missing components.

• Post-translational modification differences: Ensure that expression systems provide appropriate post-translational modifications, particularly palmitoylation which is critical for MC1R function in UV protection .

• Species-specific differences: When extrapolating from animal models or across primate species, consider potential species-specific differences in MC1R function. Use comparative approaches to identify conserved and divergent mechanisms .

• Temporal dynamics: In vitro studies often capture a single time point, while in vivo function involves dynamic regulation. Consider time-course experiments and pharmacokinetic/pharmacodynamic modeling to better understand temporal aspects of MC1R function.

How might MC1R-targeted therapies evolve based on comparative studies between human and non-human primate MC1R?

Comparative studies between human and Presbytis comata MC1R provide unique opportunities for developing novel therapeutic approaches. Future research directions include:

• Novel peptide agonists: Identifying regions of MC1R that are highly conserved across primates may reveal critical functional domains that could be targeted with peptide-based therapeutics with high specificity and reduced off-target effects.

• Targeted radionuclide therapy: Building on the success of MC1R-targeted imaging tracers like [203Pb]VMT01 and [68Ga]VMT02 , comparative studies could inform the development of therapeutics that specifically target melanoma cells expressing MC1R while sparing normal tissues.

• UV-protective interventions: Understanding the palmitoylation-dependent protective mechanisms of MC1R against UV-induced chromosome damage could lead to novel interventions to enhance this protection in individuals with compromised MC1R function.

• Personalized medicine approaches: Insights from comparative primate studies could inform more precise risk assessment and preventive strategies for individuals with specific MC1R variants .

• Evolutionary medicine: Studying MC1R adaptations across primate species that evolved in different UV environments could reveal natural protective mechanisms that could be mimicked therapeutically.

What emerging technologies might advance our understanding of Presbytis comata MC1R structure and function?

Several cutting-edge technologies hold promise for advancing MC1R research:

• Cryo-electron microscopy: This technology can reveal the three-dimensional structure of MC1R in various activation states, providing insights into ligand binding and conformational changes.

• CRISPR/Cas9 genome editing: Creating precise modifications in MC1R genes can help elucidate structure-function relationships and validate findings from recombinant protein studies.

• Single-cell transcriptomics and proteomics: These approaches can reveal cell-type specific responses to MC1R activation and identify novel downstream pathways.

• Advanced imaging techniques: Development of MC1R-specific imaging probes could enable non-invasive monitoring of receptor expression and function in vivo .

• Artificial intelligence and molecular dynamics: Computational approaches can predict the impact of sequence variations on MC1R function and help design novel therapeutic compounds with optimized properties.