Recombinant Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize the development of that tag.
Synonyms
menA; BQ2027_MB0548C; 1,4-dihydroxy-2-naphthoate octaprenyltransferase; DHNA-octaprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
menA
Target Protein Sequence
MASFAQWVSGARPRTLPNAIAPVVAGTGAAAWLHAAVWWKALLALAVAVALVIGVNYAND YSDGIRGTDDDRVGPVRLVGSRLATPRSVLTAAMTSLALGALAGLVLALLSAPWLIAVGA ICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQALRVDWVGLAQAVATGAL SCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLAVAGVLTFVLMLATPWCVV GLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALAVAGALAFGQLS
Uniprot No.

Target Background

Function
Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to demethylmenaquinone (DMK).
Protein Families
MenA family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MenA and what is its biochemical function?

MenA (isoprenyl diphosphate:1,4-dihydroxy-2-naphthoate isoprenyltransferase) is an aromatic prenyltransferase that catalyzes a critical reaction in menaquinone (MK) biosynthesis. Specifically, MenA converts cytosolic 1,4-dihydroxy-2-naphthoate (DHNA) to membrane-bound demethylmenaquinone (DMK) by transferring a hydrophobic isoprenoid chain to the position of the ring nucleus previously occupied by the carboxylic acid function. In mycobacteria, this involves the transfer of a 45-carbon isoprenoid chain . This reaction represents the convergence point between the shikimate pathway and isopentenyl diphosphate synthesis in the menaquinone biosynthetic pathway, which is essential for electron transport in many bacteria .

What is the gene encoding MenA in Mycobacterium tuberculosis?

The gene encoding MenA in Mycobacterium tuberculosis has been identified as Rv0534c. This gene has been experimentally validated through complementation studies, where Rv0534c was shown to successfully complement a menA deletion in E. coli. Furthermore, an E. coli host expressing Rv0534c exhibited an eight-fold increase in MenA specific activity compared to the control strain harboring empty vector under similar assay conditions . The gene is essential for mycobacterial survival, making it a potential target for antimicrobial development .

What are the optimal conditions for MenA enzymatic activity?

MenA from M. tuberculosis demonstrates the following optimal conditions for enzymatic activity:

  • Cation requirement: The enzyme is absolutely dependent on the presence of a divalent cation for optimal activity, with Mg²⁺ being the most effective .

  • pH optimum: MenA is active over a wide pH range, with pH 8.5 being optimal for enzymatic activity .

  • Substrate affinity: The apparent Km values for DHNA and farnesyl diphosphate were found to be 8.2 and 4.3 μM, respectively, indicating relatively high substrate affinity .

These parameters are crucial for designing effective enzyme assays when studying MenA activity and inhibition.

How can optimal experimental design improve enzyme kinetic measurements for MenA?

For rigorous enzyme kinetic characterization of MenA, an optimized experimental design approach is recommended. Studies have shown that penalized expectation of determinant (ED)-optimal design can significantly improve the accuracy of enzyme kinetic parameter estimation compared to standard approaches . An optimal design should consider:

  • Sample timing: Strategic sampling times that maximize information content

  • Substrate concentration range: For MenA, concentrations ranging from below to well above the Km values (8.2 μM for DHNA and 4.3 μM for farnesyl diphosphate)

  • Number of replicates: Sufficient replicates to ensure statistical reliability

When implemented properly, optimal experimental design can generate high-quality estimates (RMSE < 30%) of both Vmax and Km parameters, as demonstrated in similar enzyme systems . For MenA specifically, this would involve multiple substrate concentrations around the reported Km values and appropriate sampling times to capture the initial reaction rates.

What structural information is available for MenA?

  • AlphaFold2 prediction: A high-confidence computed structure model of 1,4-dihydroxy-2-naphthoate octaprenyltransferase from Mycobacterium leprae TN is available (AF-O07134-F1) . This model has a very high global pLDDT score of 94.9, indicating high prediction confidence .

  • Key features: The model indicates a protein of 294 amino acids in length with structural features consistent with other prenyltransferases .

  • Membrane association: The structure exhibits hydrophobic regions consistent with its known membrane association, which explains the challenges in purifying the active enzyme .

While this model provides valuable insights, it should be noted that "there are no experimental data to verify the accuracy of this computed structure model" . Researchers should use this model as a starting point for hypothesis generation rather than definitive structural information.

What are the challenges in recombinant expression of MenA?

Expression and purification of MenA present several challenges primarily due to its membrane-bound nature. The following methodological considerations are important:

  • Expression systems: Previous studies have successfully expressed Rv0534c (M. tuberculosis menA) in E. coli using vectors such as pVV16 and pET28a(+) . The pVV16 vector is particularly useful as it contains both E. coli and mycobacterial origins of replication with the hsp60 promoter that functions in both organisms .

  • Purification limitations: Complete purification of active MenA has been problematic. Researchers have mostly relied on membrane preparations rather than purified enzyme for characterization, as "it was not possible to solubilize and purify the recombinant enzyme" .

  • Activity measurement: Despite purification challenges, MenA activity can be measured in membrane preparations, allowing for biochemical characterization .

For researchers attempting MenA expression, a strategic approach would involve:

  • Using shuttle vectors containing appropriate promoters (like hsp60)

  • Working with membrane preparations for activity assays

  • Considering detergent optimization for potential solubilization

  • Exploring fusion tags that might aid in solubilization while maintaining activity

How does Ro 48-8071 inhibit MenA and what can we learn from its mechanism?

Ro 48-8071, a compound originally developed as an oxidosqualene cyclase inhibitor, has been found to inhibit mycobacterial MenA activity at low micromolar concentrations . Mechanism studies reveal:

  • Inhibition pattern: Ro 48-8071 exhibits non-competitive inhibition with respect to DHNA and competitive inhibition with respect to the isoprenyldiphosphate substrate .

  • Mechanistic implications: This inhibition pattern suggests that Ro 48-8071 binds to a site that overlaps with the isoprenyldiphosphate binding site but not with the DHNA binding site.

  • Structure-activity relationship insights: Understanding this mechanism provides valuable direction for the rational design of more potent and selective MenA inhibitors.

This information can guide researchers in:

  • Designing analogs with improved selectivity and potency

  • Developing appropriate screening assays that account for the competitive nature of inhibition

  • Creating computational models to predict binding modes of potential inhibitors

How can the essentiality of MenA be experimentally validated?

Validating the essentiality of MenA is crucial for establishing its potential as a drug target. Methods for experimental validation include:

  • Complementation studies: Expression of Rv0534c has been shown to complement a menA deletion in E. coli, confirming its function . This approach uses a known menA knockout strain and tests whether the gene of interest can restore the wild-type phenotype.

  • Conditional expression systems: For essential genes like menA, conditional expression systems (such as tetracycline-inducible promoters) can be used to demonstrate that depletion of the protein leads to growth arrest or death.

  • Transposon mutagenesis: Genome-wide transposon mutagenesis studies can identify genes that cannot tolerate insertions, suggesting essentiality.

  • CRISPR interference: CRISPRi can be used to downregulate expression of menA and observe effects on bacterial viability.

The evidence indicates that "expression of Rv0534c is essential for mycobacterial survival" , reinforcing its potential as an antimicrobial target.

How does MenA from different bacterial species compare?

Comparative analysis of MenA across different bacterial species reveals important insights:

SpeciesGene IdentifierProtein LengthNotable FeaturesReference
M. tuberculosisRv0534cNot specifiedEssential for survival; Km (DHNA) = 8.2 μM
M. lepraeO07134294 aaHigh-confidence structure model available
E. coliIdentified in 1976Not specifiedWell-characterized activity in membrane preparations
M. luteusNot specifiedNot specifiedDemonstrated MenA activity in membranes

While the core function of MenA is conserved across these species, there may be species-specific differences in substrate specificity, inhibitor sensitivity, and regulation. For instance, the isoprenoid chain length transferred by MenA varies between species, with mycobacteria using a 45-carbon isoprenoid chain . These differences could potentially be exploited for species-selective inhibitor design.

How can recombination events in menA genes be detected across bacterial species?

Detecting recombination events in menA genes requires sophisticated analytical methods. Based on comparative studies of recombination detection algorithms, researchers should consider:

  • Selection of appropriate methods: Studies have shown that methods using substitution patterns or incompatibility among sites are more powerful than methods based on phylogenetic incongruence . For menA analysis, methods like CHIMAERA, MAXCHI, and GENECONV would be recommended for their superior power in detecting recombination .

  • Consideration of sequence diversity: The power of recombination detection increases with sequence divergence for most methods . When analyzing menA sequences:

    • At low divergence (θ = 10), the homoplasy test and RETICULATE methods are most powerful

    • At medium to high divergence (θ = 100-200), substitution methods like CHIMAERA, MAXCHI, and GENECONV perform best

  • Accounting for rate variation: Extreme rate variation among sites (α = 0.05) can lead to false positives in some methods, particularly the homoplasy test (30-86% false positive rate) and, at high divergence, methods like PIST (11-49% false positive rate) .

A comprehensive approach would involve using multiple complementary methods to increase confidence in detected recombination events while minimizing false positives.

What are common challenges in MenA enzyme assays and how can they be addressed?

Researchers working with MenA frequently encounter several technical challenges:

  • Membrane protein solubility: As noted in the literature, "it was not possible to solubilize and purify the recombinant enzyme" . Solution: Work with membrane preparations for activity assays rather than attempting complete purification, or explore gentle detergents for partial solubilization.

  • Substrate availability: DHNA and long-chain isoprenyl diphosphates may have limited commercial availability. Solution: Consider chemical synthesis or extraction methods, or collaborate with specialized chemistry labs.

  • Assay sensitivity: Detecting the membrane-bound product can be challenging. Solution: Develop sensitive detection methods, such as LC-MS/MS or radioactive substrates, to track product formation.

  • Reproducibility: Membrane-based assays can show significant batch-to-batch variation. Solution: Include appropriate controls with each batch and normalize results to a standard.

  • Buffer optimization: The requirement for divalent cations and specific pH conditions necessitates careful buffer optimization. Solution: Systematically test buffer conditions, maintaining Mg²⁺ concentration and pH 8.5 as starting points based on known optimal conditions .

What are the most promising research directions for MenA as a drug target?

Several high-priority research directions for MenA include:

  • Structure-guided drug design: While computed structure models provide a starting point , experimental structure determination (e.g., cryo-EM of the membrane-bound enzyme) would significantly advance structure-based drug design efforts.

  • Fragment-based screening: Given the challenges of working with membrane proteins, fragment-based approaches might identify novel chemical scaffolds with activity against MenA.

  • Resistance mechanisms: Investigating potential resistance mechanisms to MenA inhibitors would inform the development of more robust therapeutic strategies.

  • In vivo validation: Further studies to validate the efficacy of MenA inhibition in animal models of infection would strengthen the case for MenA as a drug target.

  • Combination therapy approaches: Exploring synergistic effects between MenA inhibitors and existing antibiotics could lead to more effective treatment strategies, particularly for drug-resistant infections.

The menaquinone biosynthetic pathway, including MenA, continues to be a promising area for antimicrobial development, particularly against Mycobacterium tuberculosis and other Gram-positive pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.