Recombinant Probable ABC transporter permease protein ycf63 (ycf63)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Probable ABC Transporter Permease Protein ycf63

Recombinant Probable ABC Transporter Permease Protein ycf63, commonly referred to as ycf63, is a protein encoded by the ycf63 gene found in Porphyra purpurea (red seaweed). This protein is part of the ATP-binding cassette (ABC) transporter family, which is known for its role in transporting various molecules across cellular membranes. The full-length protein consists of 263 amino acids and is characterized by its ability to facilitate the movement of substrates, potentially including ions and small organic molecules, across the membrane.

Functional Insights

Research indicates that ycf63 may play a critical role in various physiological processes, particularly in the context of photosynthesis and cellular transport mechanisms. The protein's involvement in the assembly of photosystems and its potential interaction with other proteins within the chloroplast have been documented in several studies.

Key Findings from Research

  • Role in Photosystem Assembly: Studies have highlighted ycf63's involvement in the assembly of photosystem I, an essential component for photosynthesis in plants and algae .

  • Transport Mechanism: As a probable ABC transporter, ycf63 likely facilitates the translocation of substrates across membranes, which is crucial for nutrient uptake and waste elimination within cells .

Experimental Applications

The recombinant form of ycf63 has been utilized in various experimental settings:

  • SDS-PAGE Analysis: The purity and molecular weight of the protein can be assessed using SDS-PAGE techniques.

  • Functional Assays: Further studies may involve functional assays to determine substrate specificity and transport efficiency.

References

  1. Creative BioMart. Recombinant Full Length Probable ABC Transporter Permease Protein Ycf63 (ycf63) Protein .

  2. Functional Studies of Ycf3: Its Role in Assembly of Photosystem I .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery time estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your request.
Synonyms
ycf63; Probable ABC transporter permease protein ycf63
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Porphyra purpurea (Red seaweed) (Ulva purpurea)
Target Names
ycf63
Target Protein Sequence
MFQFELKKWIQKLNSTLSLFVSLLARLRTMKINTSSLAEQIYLVGPGSLNITLLTACFIS MVFTMQIAKEFLHLDAASALGAVIVIAFTRELSPVLTAVIIAGKIGSSFTAEIATMETTE QIDALYLLNTNPIDYLVFPKVAACCIMLPILSTISLTASIAISIFVSFVMYGIPSSIFLK SAFLALSVSDFFSCLQKSLCFGTIIAFISCQWGLTSSGGAKGVGNSTTSSVVTILLTIFI TDFILSYFMFQSTGSSIAQGNNL
Uniprot No.

Target Background

Function
This protein could be part of an ABC transporter complex.
Protein Families
MlaE permease family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Probable ABC Transporter Permease Protein ycf63?

Recombinant Probable ABC transporter permease protein ycf63 is a laboratory-expressed version of the naturally occurring ycf63 protein found in certain photosynthetic organisms. It is encoded by the ycf63 gene identified in red algae species and is classified as a component of ATP-binding cassette (ABC) transporter systems. The recombinant protein is typically expressed in E. coli with a histidine tag to facilitate purification and subsequent research applications . The "probable" designation in its name reflects that while sequence analysis strongly suggests its function as an ABC transporter permease, comprehensive functional characterization is still developing in the scientific literature.

How should researchers design experiments to study ycf63 function?

When designing experiments to study ycf63 function, researchers should adhere to rigorous experimental design principles that establish causal relationships. Following the "If X, then Y" and "If not X, then not Y" paradigm is critical for demonstrating causality in ycf63 function . Researchers should:

  • Establish appropriate control groups that are identical to experimental groups except for the variable being tested

  • Implement randomization where applicable to minimize bias

  • Ensure adequate replication for statistical validity

  • Consider blinding techniques to reduce experimenter bias

  • Follow a sequential experimental approach:

    • Begin with binding studies to identify potential substrates

    • Progress to transport kinetics measurements

    • Perform inhibitor studies to characterize transport mechanisms

    • Conduct structure-function analyses using site-directed mutagenesis

To enhance validity, researchers should incorporate both positive controls (known functional ABC transporters) and negative controls (inactive mutants or ATP-free conditions) in their experimental design.

What reconstitution protocols are recommended for lyophilized ycf63?

For optimal reconstitution of lyophilized ycf63, the following methodological steps are recommended:

  • Centrifuge the vial briefly before opening to ensure the powder is at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Mix gently by inversion or mild vortexing until completely dissolved

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Divide into small aliquots to prevent repeated freeze-thaw cycles

  • Store aliquots at -20°C to -80°C for long-term storage or at 4°C for up to one week for working solutions

Quality control assessment via SDS-PAGE after reconstitution is advisable to confirm protein integrity. The reconstituted protein should be handled in Tris/PBS-based buffer systems at pH 8.0 to maintain stability .

What experimental techniques are most suitable for investigating ycf63?

Several experimental techniques are particularly suitable for investigating ycf63, given its nature as a membrane transport protein:

  • Membrane Reconstitution Assays:

    • Proteoliposome preparation with defined lipid compositions

    • Substrate transport measurements across reconstituted membranes

    • Co-reconstitution with appropriate nucleotide-binding domains (NBDs)

  • Biophysical Characterization:

    • Circular dichroism spectroscopy for secondary structure analysis

    • Limited proteolysis to assess proper folding

    • Detergent solubility profiles to verify membrane protein characteristics

  • Functional Assessment:

    • ATPase activity assays (when paired with appropriate NBD components)

    • Substrate binding studies using fluorescence-based or radioisotope approaches

    • Transport kinetics measurements in reconstituted systems

  • Structural Analysis:

    • Cryo-electron microscopy for structural determination

    • Cross-linking studies to identify interaction domains

    • Accessibility studies to map membrane topology

  • Interaction Studies:

    • Pull-down assays to identify protein partners

    • Co-immunoprecipitation to verify protein-protein interactions

    • Blue native PAGE to analyze complex formation

These techniques should be selected based on the specific research questions being addressed and available resources.

How can researchers validate the activity of recombinant ycf63?

Validating the activity of recombinant ycf63 requires a multi-faceted approach to ensure the protein is correctly folded and functional:

  • Structural Integrity Assessment:

    • Verify proper secondary structure using circular dichroism spectroscopy

    • Confirm membrane integration capability through detergent extraction profiling

    • Assess thermal stability through differential scanning fluorimetry

  • Functional Validation Approaches:

    • For complete ABC transporters (ycf63 plus appropriate NBD):

      • Measure ATP hydrolysis rates using colorimetric phosphate release assays

      • Monitor conformational changes associated with ATP binding/hydrolysis

      • Quantify substrate transport in reconstituted systems

  • Comparative Validation:

    • Benchmark against well-characterized ABC transporters as positive controls

    • Compare activities between fresh preparations and stored samples

    • Validate using multiple independent functional assays

  • Systematic Controls:

    • Include non-functional mutants (e.g., mutations in conserved residues)

    • Test with non-hydrolyzable ATP analogs to establish ATP dependence

    • Evaluate activity across a range of physical conditions (pH, temperature, ionic strength)

This comprehensive validation approach ensures that subsequent functional studies are based on properly folded, active protein.

What are the approaches for studying ycf63 in transport mechanisms?

To study the role of ycf63 in transport mechanisms, researchers can implement several methodological approaches:

  • Substrate Identification:

    • Screen potential substrates based on homology to characterized ABC transporters

    • Develop transport assays using fluorescent or radioactively labeled compounds

    • Implement competition assays to determine substrate specificity

  • Transport Assay Systems:

    • Proteoliposome-based transport assays:

      • Reconstitute purified ycf63 (with appropriate NBD) into liposomes

      • Monitor substrate accumulation inside vesicles or substrate efflux

      • Quantify transport rates under varying conditions

  • Kinetic Analysis:

    • Determine transport kinetics by varying substrate concentrations

    • Measure ATP hydrolysis rates in relation to transport activity

    • Analyze the effects of inhibitors on transport kinetics

  • Structure-Function Studies:

    • Create site-directed mutants targeting conserved residues

    • Perform alanine-scanning mutagenesis of predicted substrate-binding domains

    • Analyze chimeric constructs with related transporters to identify functional domains

  • Physiological Context Investigation:

    • Develop heterologous expression systems to study transport in cellular contexts

    • Analyze the impact of physiological regulators on transport activity

    • Investigate the effects of relevant lipid environments on transporter function

These approaches provide a comprehensive framework for understanding the transport mechanisms mediated by ycf63.

What common challenges occur in ycf63 expression and how can they be addressed?

Expressing membrane proteins like ycf63 presents several technical challenges that researchers should anticipate:

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Use specialized E. coli strains designed for membrane protein expression

      • Test different fusion tags beyond His-tag (MBP, SUMO, etc.)

      • Experiment with lower induction temperatures (16-20°C)

  • Protein Misfolding:

    • Challenge: Tendency toward inclusion body formation

    • Solutions:

      • Co-express with molecular chaperones

      • Utilize mild induction conditions (lower IPTG concentrations)

      • Consider cell-free expression systems

      • Test detergent screening for optimal solubilization

  • Purification Difficulties:

    • Challenge: Maintaining protein stability during extraction from membranes

    • Solutions:

      • Screen multiple detergents for extraction efficiency while preserving function

      • Include stabilizing agents in purification buffers

      • Implement tangential flow filtration for gentle concentration

      • Consider nanodiscs or amphipols for increased stability

  • Protein Degradation:

    • Challenge: Proteolytic degradation during expression and purification

    • Solutions:

      • Add protease inhibitors during all purification steps

      • Reduce purification time through optimized protocols

      • Use protease-deficient expression strains

      • Maintain low temperatures throughout the purification process

Addressing these challenges requires systematic optimization of expression and purification conditions specific to ycf63.

How should researchers interpret contradictory experimental results involving ycf63?

When facing contradictory results in ycf63 research, a structured analytical approach can help resolve discrepancies:

  • Quality Control Assessment:

    • Verify protein quality through multiple analytical methods (SDS-PAGE, Western blot, mass spectrometry)

    • Confirm activity using complementary functional assays

    • Assess batch-to-batch consistency in protein preparations

  • Experimental Variables Analysis:

    • Systematically examine all experimental variables:

      • Buffer composition differences (pH, salt concentration, additives)

      • Temperature and incubation time variations

      • Reagent sources and lot numbers

      • Equipment calibration and settings

  • Methodological Comparison:

    • Compare methodological details with published protocols

    • Consult with collaborators using similar systems

    • Consider differences in data analysis approaches

  • Biological Context Consideration:

    • Evaluate whether contradictions reflect true biological complexity

    • Consider allosteric regulation or multiple functional states

    • Assess whether the protein functions differently under various conditions

  • Systematic Resolution Approach:

    • Design discriminating experiments to directly test contradictory findings

    • Implement orthogonal methods to validate results

    • Consider mathematical modeling to reconcile apparent contradictions

By systematically analyzing contradictory results, researchers can gain deeper insights into the complex behavior of ycf63 and its functional mechanisms.

What statistical approaches are appropriate for analyzing ycf63 experimental data?

Proper statistical analysis is crucial for interpreting ycf63 experimental data:

  • Descriptive Statistics:

    • Calculate means, standard deviations, and standard errors for replicate measurements

    • Present data distributions to assess normality

    • Use appropriate graphical representations (bar charts, scatter plots, box plots)

  • Inferential Statistics:

    • For comparing two conditions: t-tests (paired or unpaired as appropriate)

    • For multiple conditions: ANOVA with appropriate post-hoc tests

    • For non-normally distributed data: non-parametric alternatives (Mann-Whitney, Kruskal-Wallis)

  • Regression Analysis:

    • For kinetic data: non-linear regression to fit enzyme kinetic models

    • For dose-response data: sigmoidal curve fitting

    • For correlation analysis: appropriate correlation coefficients with significance testing

  • Statistical Power Considerations:

    • Perform power analysis to determine adequate sample sizes

    • Report effect sizes along with p-values

    • Implement multiple comparison corrections for large datasets

  • Reproducibility Enhancement:

    • Pre-register experimental designs when possible

    • Report all data exclusions and their justifications

    • Share raw data and analysis scripts for transparency

When analyzing experimental data from transport studies or binding assays, appropriate model fitting (e.g., Michaelis-Menten, Hill equation, or more complex models) should be employed to extract meaningful kinetic parameters.

How can researchers compare ycf63 with other ABC transporter proteins?

Comparative analysis of ycf63 with other ABC transporters requires a structured approach:

  • Sequence-Based Comparison:

    • Multiple sequence alignments to identify conserved motifs

    • Phylogenetic analysis to determine evolutionary relationships

    • Conservation scoring to highlight functionally important residues

  • Structural Comparison:

    • Homology modeling based on solved ABC transporter structures

    • Comparative analysis of predicted transmembrane domains

    • Evaluation of substrate-binding pocket architecture

  • Functional Comparison:

    • Standardized assay conditions for direct comparison of transport activities

    • Substrate specificity profiling across related transporters

    • Inhibitor sensitivity patterns to classify functional groups

  • Expression and Regulation Comparison:

    • Analysis of gene context and operon structure across species

    • Comparison of expression patterns in response to environmental conditions

    • Evaluation of post-translational modifications and their effects

  • Data Presentation Format:

Featureycf63 (P. purpurea)ycf63 (P. yezoensis)Related ABC Transporters
Length263 aa263 aaVariable (typically 250-350 aa for TMDs)
SourceChloroplast genomeChloroplast genomeNuclear genome (typical)
Host for Recombinant ExpressionE. coliE. coliVarious expression systems
TagsHis-tagHis-tagVarious affinity tags
Predicted TMDsMultipleMultipleTypically 6 per TMD unit

This comparative framework enables researchers to place ycf63 within the broader context of ABC transporter biology and evolution.

What are emerging techniques that could advance ycf63 research?

Several emerging techniques hold promise for advancing our understanding of ycf63:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination without crystallization

    • Visualization of different conformational states during transport cycle

    • Analysis of ycf63 in complex with binding partners

  • Native Mass Spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of binding stoichiometry

    • Identification of lipids and small molecules associated with ycf63

  • Single-Molecule Techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Single-molecule transport assays to observe heterogeneity in function

    • Optical tweezers to measure forces involved in transport mechanism

  • Advanced Reconstitution Systems:

    • Nanodiscs for stable membrane protein reconstitution

    • Droplet interface bilayers for electrical measurements

    • Microfluidic systems for high-throughput functional analysis

  • Computational Approaches:

    • Molecular dynamics simulations of transport mechanisms

    • Machine learning for substrate prediction

    • Systems biology modeling of ABC transporter networks

These techniques can be applied to address fundamental questions about ycf63 structure, function, and biological role.

How might experimental data on ycf63 be integrated into systems biology approaches?

Integrating ycf63 experimental data into systems biology frameworks can provide broader insights:

  • Network Integration:

    • Map ycf63 into metabolic networks of photosynthetic organisms

    • Identify potential metabolic pathways influenced by ycf63 transport

    • Model the impact of ycf63 dysfunction on cellular homeostasis

  • Multi-omics Data Integration:

    • Correlate ycf63 activity with transcriptomic, proteomic, and metabolomic datasets

    • Identify co-regulated genes and proteins under various conditions

    • Discover potential regulatory mechanisms and feedback loops

  • Comparative Systems Analysis:

    • Compare system-level effects of ycf63 across different photosynthetic organisms

    • Evaluate evolutionary conservation of ycf63-dependent processes

    • Identify species-specific adaptations in ycf63 function

  • Predictive Modeling:

    • Develop mathematical models of transport kinetics and their cellular impacts

    • Simulate the effects of environmental changes on ycf63-mediated processes

    • Generate testable hypotheses for experimental validation

  • Experimental Design for Systems Validation:

    • Design perturbation experiments to test system-level predictions

    • Implement time-course studies to capture dynamic responses

    • Develop reporter systems to monitor ycf63-dependent processes in vivo

This systems-level approach can place the molecular understanding of ycf63 into a broader biological context, revealing its role in cellular and organismal physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.