Recombinant Probable adenylyltransferase/sulfurtransferase MoeZ (moeZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Target Names
moeZ
Target Protein Sequence
MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLY LAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELR LAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAP DGLGVNYRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEAL AAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY
Uniprot No.

Q&A

What is MoeZ and which superfamily does it belong to?

MoeZ is a member of a superfamily consisting of related but structurally distinct proteins involved in pathways for the transfer of sulfur-containing moieties to metabolites. This superfamily includes MoeB, MoeBR, MoeZ, and MoeZdR proteins. The most characterized member of this family is MoeB, which functions as the molybdopterin synthase activating enzyme in the molybdopterin cofactor biosynthesis pathway .

MoeZ was initially identified by the Mycobacterium tuberculosis genome sequencing group at the Sanger Center. Although it shows high sequence similarity to MoeB, it was named MoeZ because it lacked genetic linkage to other molybdopterin-molybdenum (MPT-Mo) synthesis genes. Unlike MoeB, which is directly involved in molybdopterin synthesis, MoeZ's exact biochemical function has shown greater diversity across bacterial species .

How does the primary structure of MoeZ differ from related proteins like MoeB and MoeBR?

MoeZ differs from related proteins primarily in domain architecture and critical motifs. The key structural differences can be summarized in the following table:

ProteinThiF Domain2X CXXC DomainRhodanese-like DomainPolyproline MotifPosition 155
MoeBPresentIntact (both CXXC pairs)AbsentAbsentI (Isoleucine)
MoeBRPresentIntact (both CXXC pairs)PresentPresentY (Tyrosine)
MoeZPresentMissing cysteines in CXXC motifsPresentPresentF or Y (Phenylalanine or Tyrosine)
MoeZdRPresentFirst CXXC substituted with GYRDPresent (partial)VariesVaries

The most distinguishing feature of MoeZ is the absence of the cysteines in the CXXC motifs that are present in MoeB. This absence is significant because these cysteine pairs form a metal center with a zinc atom in MoeB, which is required for its activity as a molybdopterin synthase activating enzyme .

Which organisms have been found to contain MoeZ homologs?

Homologs of MoeZ have been identified in diverse bacterial species with varying degrees of sequence similarity. Notably, Pseudomonas stutzeri MoeZ (Ps-MoeZ) shows high sequence homology to proteins from several bacterial genera:

  • Mycobacterium species

  • Mesorhizobium species

  • Pseudomonas species

  • Streptomyces species

  • Cyanobacteria

Interestingly, Ps-MoeZ exhibits higher similarity to some mycobacterial, streptomycete, and cyanobacterial sequences than to other pseudomonad sequences. For example, nucleic acid BLAST searches revealed that Ps-moeZ had greater homology to four sequences from these bacteria than to other pseudomonad sequences .

How does the absence of CXXC motifs in MoeZ affect its function compared to MoeB?

The absence of the dual CXXC motifs in MoeZ represents a critical functional divergence from MoeB. In MoeB, these cysteines form a metal center with a zinc atom, which is essential for its activity as a molybdopterin synthase activating enzyme .

The functional implications of this absence include:

  • Loss of Metal Coordination: MoeZ cannot coordinate zinc in the same manner as MoeB, suggesting a different catalytic mechanism.

  • Alternative Substrate Binding: The structural changes likely alter the substrate specificity of MoeZ compared to MoeB.

  • Functional Compensation: The presence of the rhodanese-like domain in MoeZ may compensate for the loss of the CXXC motifs, potentially providing an alternative mechanism for sulfur transfer.

To experimentally determine the functional consequences of these differences, researchers should consider:

  • Comparing the sulfurtransferase activity of MoeZ and MoeB using various potential substrates

  • Performing metal binding assays to determine if MoeZ coordinates different metals or uses a different mechanism

  • Creating chimeric proteins with domains swapped between MoeZ and MoeB to identify which regions are responsible for the functional differences

What crystallographic considerations are important when attempting to resolve the three-dimensional structure of MoeZ?

When attempting to resolve the crystal structure of MoeZ, researchers should address several key considerations:

A statistical approach to analyze diffraction data quality might use the following ANOVA framework:

Source of VariationSSDFMSF
Resolution shellsX₁n₁-1X₁/(n₁-1)[X₁/(n₁-1)]/MSE
Crystal formsX₂n₂-1X₂/(n₂-1)[X₂/(n₂-1)]/MSE
ErrorX₃n₃X₃/n₃
TotalX₁+X₂+X₃n₁+n₂+n₃-2

Where the F-statistic would be compared to critical values to determine significant effects .

What enzymatic assays can be developed to characterize MoeZ activity?

To characterize MoeZ activity, researchers should develop assays that address both its proposed adenylyltransferase and sulfurtransferase functions:

  • Adenylyltransferase Activity Assay:

    • Measure the ATP-dependent adenylylation of potential substrates

    • Use radioactively labeled ATP (³²P-ATP) to track the formation of adenylylated intermediates

    • Monitor AMP release using coupled enzyme assays (with myokinase, pyruvate kinase, and lactate dehydrogenase)

  • Sulfurtransferase Activity Assay:

    • Employ thiosulfate as a sulfur donor and cyanide as an acceptor to assess rhodanese-like activity

    • Measure the formation of thiocyanate spectrophotometrically

    • Use isotopically labeled sulfur sources (³⁵S) to track sulfur transfer to acceptor molecules

  • Combined Adenylylation-Sulfur Transfer Assay:

    • Design a two-step assay that first measures adenylylation of the substrate followed by sulfur transfer

    • Utilize mass spectrometry to detect the thiocarboxylate formation on acceptor proteins or small molecules

The data should be analyzed using statistical methods such as those described in search result , particularly the fixed effects model for estimating parameters when comparing MoeZ activity across different conditions:

μ^i=yi1++yinn=yˉi.\hat{\mu}_i = \frac{y_{i1} + \ldots + y_{in}}{n} = \bar{y}_{i.}

Where μᵢ represents the mean activity under condition i, and y₍ᵢⱼ₎ represents individual measurements .

How does the rhodanese-like domain in MoeZ contribute to its function?

The rhodanese-like domain in MoeZ plays a critical role in its function, particularly in sulfur transfer reactions. To investigate this domain's contribution:

  • Domain Function Analysis:

    • Create truncated versions of MoeZ lacking the rhodanese-like domain

    • Generate point mutations in conserved residues within the rhodanese domain

    • Assess the activity of these variants compared to wild-type MoeZ

  • Rhodanese Activity Testing:

    • Compare the thiosulfate:cyanide sulfurtransferase activity of full-length MoeZ versus the isolated rhodanese domain

    • Investigate whether the ThiF domain influences the activity of the rhodanese domain through allosteric effects

  • Structural Interaction Studies:

    • Use chemical crosslinking to determine if the rhodanese domain interacts with the ThiF domain

    • Employ hydrogen-deuterium exchange mass spectrometry to identify regions of conformational flexibility between domains

Research indicates that the rhodanese-like domain likely provides MoeZ with sulfurtransferase capability that is absent in MoeB proteins lacking this domain. This is particularly significant given that MoeZ lacks the CXXC motifs that typically coordinate zinc in MoeB proteins .

What are the potential in vivo substrates of MoeZ in different bacterial species?

Identifying the in vivo substrates of MoeZ requires a comprehensive approach:

  • Comparative Genomic Analysis:

    • Examine the genomic context of moeZ across different bacterial species

    • Identify co-occurring genes that might encode potential substrates or pathway components

    • For instance, in Pseudomonas stutzeri, moeZ (ORF-F) is part of the pdt locus involved in pyridine-2,6-bis(thiocarboxylic acid) synthesis

  • Protein-Protein Interaction Studies:

    • Implement pull-down assays using tagged MoeZ as bait

    • Perform bacterial two-hybrid screening to identify interacting proteins

    • Use chemical crosslinking followed by mass spectrometry to capture transient interactions

  • Metabolomic Approaches:

    • Compare metabolite profiles between wild-type and moeZ knockout strains

    • Focus on thiocarboxylated molecules and sulfur-containing metabolites

    • Use stable isotope labeling to track sulfur transfer in vivo

Potential substrates may vary across species based on the table below:

Bacterial SpeciesGenomic ContextPotential SubstratesAssociated Pathways
P. stutzeripdt locusComponents of pyridine-2,6-bis(thiocarboxylic acid) synthesisSiderophore production
M. tuberculosisNot linked to MPT-Mo genesUnknown, possibly involved in alternative sulfur transferPotential role in virulence
Streptomyces speciesVariablePossible role in secondary metabolite biosynthesisAntibiotic production
CyanobacteriaVariablePotential involvement in photosynthetic sulfur metabolismEnergy production

What phylogenetic approaches best reveal the evolutionary relationships between MoeZ and related proteins?

To effectively analyze the evolutionary relationships between MoeZ and related proteins, researchers should employ multiple phylogenetic approaches:

  • Sequence-Based Phylogenetic Analysis:

    • Collect a comprehensive set of MoeZ, MoeB, MoeBR, and MoeZdR sequences

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Construct phylogenetic trees using both distance-based methods (Neighbor-Joining) and character-based methods (Maximum Likelihood, Bayesian inference)

    • Apply appropriate substitution models (e.g., JTT, WAG, or LG for protein sequences)

    • Implement bootstrap analysis (>1000 replicates) to assess node support

  • Domain Architecture Analysis:

    • Map the presence/absence and arrangement of key domains (ThiF, rhodanese-like, 2X CXXC)

    • Trace domain gain/loss events across the phylogenetic tree

    • Identify potential recombination events that may have led to new domain combinations

  • Synteny Analysis:

    • Compare the genomic context of moeZ and related genes across bacterial species

    • Identify conserved gene neighborhoods that might indicate functional relationships

    • Track genomic rearrangements that correlate with functional divergence

The analysis should be statistically rigorous, using approaches similar to those in search result , particularly when comparing sequence conservation across different domains or protein families.

How has MoeZ evolved functionally divergent roles across bacterial species?

The functional divergence of MoeZ across bacterial species represents a fascinating case of evolutionary adaptation:

  • Selective Pressure Analysis:

    • Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) across the MoeZ coding sequence

    • Identify sites under positive selection using methods like PAML or HyPhy

    • Correlate these sites with known functional regions or predicted substrate binding sites

  • Correlation with Ecological Niches:

    • Compare MoeZ sequences from bacteria occupying different ecological niches

    • Analyze whether specific MoeZ variants correlate with particular environmental adaptations

    • Investigate if horizontal gene transfer events have contributed to MoeZ distribution

  • Functional Adaptation Evidence:

    • In Pseudomonas stutzeri, MoeZ appears to be involved in the synthesis of pyridine-2,6-bis(thiocarboxylic acid), a siderophore

    • In Mycobacterium tuberculosis, despite sequence similarity to MoeB, MoeZ likely performs different functions since it has no genetic linkage to MPT-Mo synthesis genes

A comparative analysis of MoeZ function across bacterial species might be structured as follows:

Bacterial CladeMoeZ Structural FeaturesPredicted FunctionEvidence
Pseudomonas spp.ThiF domain + rhodanese domain, lacks CXXC motifsInvolved in siderophore biosynthesisPart of pdt locus in P. stutzeri
MycobacteriaThiF domain + rhodanese domain, lacks CXXC motifsUnknown, not linked to molybdopterin synthesisNot genetically linked to MPT-Mo genes
StreptomycesThiF domain + rhodanese domain, lacks CXXC motifsPotentially involved in secondary metabolite productionGenomic context suggests role in specialized metabolism
CyanobacteriaThiF domain + rhodanese domain, lacks CXXC motifsPossible role in photosynthetic metabolismDistribution in photosynthetic bacteria

What methods can identify key residues responsible for functional specificity in MoeZ?

To identify key residues responsible for functional specificity in MoeZ, researchers should employ a combination of computational and experimental approaches:

  • Specificity-Determining Position (SDP) Prediction:

    • Use specialized algorithms (e.g., SDPpred, Multi-RELIEF, or Speer) to identify positions that distinguish MoeZ from related proteins

    • These methods analyze multiple sequence alignments to find positions conserved within subfamilies but different between them

  • Structural Analysis of Divergent Sites:

    • Map predicted SDPs onto structural models of MoeZ

    • Analyze whether these residues cluster in potential substrate-binding pockets or at domain interfaces

    • Compare these positions to known functional sites in related proteins like MoeB

  • Experimental Validation:

    • Perform site-directed mutagenesis of predicted SDPs

    • Create chimeric proteins by swapping regions between MoeZ and related proteins

    • Assess the functional consequences of these mutations using the enzymatic assays described earlier

Statistical analysis of SDP prediction results should employ rigorous methods to distinguish signal from noise, potentially using approaches similar to the ANOVA framework described in search result .

What expression systems optimize yield and activity of recombinant MoeZ?

Optimizing the expression of recombinant MoeZ requires careful consideration of several factors:

  • Expression Host Selection:

    • E. coli systems: BL21(DE3), Rosetta, or Origami strains may be appropriate depending on codon usage and disulfide bond requirements

    • Mycobacterial expression systems: Consider for expression of mycobacterial MoeZ to ensure proper folding

    • Cell-free systems: May be useful for producing proteins that are toxic to host cells

  • Vector and Fusion Tag Optimization:

    • Test multiple fusion tags (His₆, GST, MBP, SUMO) to identify optimal solubility and activity

    • Consider dual affinity tags for enhanced purification

    • Evaluate the impact of tag position (N-terminal vs. C-terminal) on protein folding and activity

  • Expression Condition Optimization Using Factorial Design:

    • Implement a balanced incomplete block design as described in search result when testing multiple conditions

    • Systematically vary parameters including temperature, inducer concentration, and induction time

    • The experimental design might be structured as follows:

FactorLevelsDescription
Temperature16°C, 25°C, 37°CInduction temperature
IPTG concentration0.1 mM, 0.5 mM, 1.0 mMInducer concentration
Induction time4h, 8h, 16hDuration of induction
MediaLB, TB, Auto-inductionGrowth medium

Statistical analysis of the results should follow the fixed effects model described in search result :

E(MStr)=σ2+bi=1aτi2a1E(MS_{tr}) = \sigma^2 + \frac{b\sum_{i=1}^{a}\tau_i^2}{a-1}

Where MSₜᵣ represents the mean square for treatments, σ² is the error variance, b is the number of blocks, a is the number of treatments, and τᵢ represents the treatment effect .

How should site-directed mutagenesis experiments be designed to investigate MoeZ function?

Site-directed mutagenesis experiments for MoeZ should be systematically designed to probe its function:

  • Target Residue Selection:

    • Focus on positions corresponding to the absent CXXC motifs in MoeZ

    • Target the position 155 (Ec-MoeB numbering) where MoeZ has F or Y instead of I as in MoeB

    • Identify conserved residues in the rhodanese-like domain that may be involved in sulfur transfer

  • Mutation Strategy:

    • For each target position, consider multiple substitutions:

      • Conservative substitutions that maintain chemical properties

      • Non-conservative substitutions that alter chemical properties

      • Substitutions that mimic related proteins (e.g., changing F/Y at position 155 to I as in MoeB)

  • Experimental Controls:

    • Include wild-type MoeZ as a positive control

    • Consider related proteins (MoeB, MoeBR) as functional references

    • Include inactive mutants (e.g., mutations in ATP binding sites) as negative controls

  • Functional Assay Selection:

    • Test each mutant in multiple assays to comprehensively assess function

    • Include assays for both adenylyltransferase and sulfurtransferase activities

    • Assess protein stability to ensure that activity changes are not due to protein misfolding

A typical mutagenesis experiment might be structured as follows:

Mutation CategoryTarget ResiduesSubstitutionsExpected Outcome
CXXC motif sitesResidues corresponding to CXXC positions in MoeBC→S, C→A, X→AAssess if introducing cysteines can confer MoeB-like function
Position 155F/Y in MoeZF/Y→I, F/Y→A, F/Y→WDetermine role in substrate specificity
Rhodanese domainConserved residuesAlanine scanningIdentify residues essential for sulfurtransferase activity
ATP bindingWalker A motifK→ANegative control for adenylylation activity

What statistical approaches are most appropriate for analyzing MoeZ enzymatic assay data?

A typical ANOVA table for analyzing differences in MoeZ activity across multiple mutants might look like:

Source of VariationSum of SquaresdfMean SquareFp-value
Between mutantsSS₁k-1MS₁ = SS₁/(k-1)MS₁/MSEp
ErrorSS₂N-kMSE = SS₂/(N-k)
TotalSS₁+SS₂N-1

Where k is the number of mutants and N is the total number of observations .

How can protein-protein interaction studies reveal MoeZ's role in cellular pathways?

To elucidate MoeZ's role in cellular pathways through protein-protein interactions, researchers should employ multiple complementary approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged MoeZ in native host organisms

    • Perform pull-down experiments under varying conditions (different growth phases, stress conditions)

    • Analyze co-purifying proteins using high-resolution mass spectrometry

    • Implement appropriate controls (e.g., tag-only, unrelated protein) to identify specific interactions

  • Bacterial Two-Hybrid Analysis:

    • Screen genomic libraries to identify potential interaction partners

    • Confirm interactions using targeted pairwise tests

    • Analyze domain-specific interactions by creating truncated versions of MoeZ

  • In vivo Crosslinking:

    • Use chemical crosslinkers or photo-crosslinking to capture transient interactions

    • Apply formaldehyde crosslinking for capturing protein complexes in living cells

    • Combine with mass spectrometry for identification of crosslinked peptides

  • Co-occurrence Analysis:

    • Create a co-occurrence table similar to those described in search result

    • Analyze patterns of protein co-expression across conditions

    • Example format:

Interaction PartnerTechniqueEvidenceConfirmed in Multiple Species?Functional Category
Protein XAP-MSScore: X, p-value: YYes/NoSulfur metabolism
Protein YBacterial 2HGrowth on selective mediaYes/NoMolybdenum cofactor biosynthesis
Protein ZCrosslinkingMS/MS identificationYes/NoUnknown function

What computational approaches can predict MoeZ substrates and binding partners?

Advanced computational methods can provide valuable insights into MoeZ substrates and binding partners:

  • Protein-Protein Docking:

    • Generate structural models of MoeZ using homology modeling

    • Perform molecular docking with potential partner proteins

    • Analyze binding energy and interface residues

    • Validate predictions through mutagenesis of predicted interface residues

  • Machine Learning Approaches:

    • Train models using known enzyme-substrate pairs from related systems

    • Incorporate features such as surface electrostatics, hydrophobicity, and structural complementarity

    • Apply trained models to predict novel MoeZ substrates

  • Molecular Dynamics Simulations:

    • Simulate MoeZ dynamics in explicit solvent

    • Analyze conformational changes that might expose binding sites

    • Perform steered molecular dynamics to investigate substrate binding/release pathways

  • Network Analysis:

    • Construct protein-protein interaction networks incorporating MoeZ

    • Identify potential functional modules through clustering analysis

    • Analyze network topology to predict functional relationships

Data from these computational approaches should be organized in tables similar to the typologically ordered tables described in search result , which would facilitate systematic comparison of predicted interactions across different computational methods.

How can contradictory findings about MoeZ function be resolved methodologically?

Resolving contradictory findings about MoeZ function requires a systematic methodological approach:

What emerging technologies could advance understanding of MoeZ function?

Several emerging technologies hold promise for advancing our understanding of MoeZ function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Apply single-particle cryo-EM to resolve MoeZ structure, particularly in complex with substrates or partner proteins

    • Use time-resolved cryo-EM to capture different conformational states during the catalytic cycle

    • Implement focused classification approaches to deal with conformational heterogeneity

  • Proximity Labeling Proteomics:

    • Fuse MoeZ to enzymes like BioID or APEX2 to identify proximal proteins in vivo

    • Apply quantitative proteomics to measure dynamic changes in the MoeZ interactome under different conditions

    • Combine with genetic perturbations to map functional relationships

  • CRISPR-Based Genetic Screens:

    • Implement genome-wide CRISPR knockout or CRISPRi screens to identify genes that genetically interact with moeZ

    • Design screens to detect synthetic lethality or suppressor relationships

    • Apply in diverse bacterial species to compare genetic interaction networks

  • Native Mass Spectrometry:

    • Use native MS to analyze intact MoeZ complexes

    • Characterize post-translational modifications that might regulate MoeZ function

    • Study dynamic assembly/disassembly of MoeZ-containing complexes

How might MoeZ function in bacterial pathogenicity and stress response?

The potential role of MoeZ in bacterial pathogenicity and stress response represents an important research direction:

  • Infection Models:

    • Compare virulence of wild-type and moeZ mutant pathogens in appropriate infection models

    • Analyze tissue-specific requirements for MoeZ during infection

    • Investigate host immune responses to MoeZ-dependent bacterial products

  • Stress Response Analysis:

    • Expose bacteria to various stresses (oxidative, nitrosative, metal limitation)

    • Compare transcriptional and proteomic profiles of wild-type and moeZ mutants

    • Create a temporally ordered table as described in search result to track stress response dynamics

  • Metabolic Adaptation:

    • Analyze how MoeZ-dependent pathways contribute to metabolic flexibility during infection

    • Investigate potential roles in biofilm formation or persistence

    • Create co-occurrence tables as described in search result to identify metabolic pathways co-regulated with moeZ

  • Comparative Genomics of Virulence:

    • Compare moeZ sequence and genomic context across pathogenic and non-pathogenic bacterial relatives

    • Identify pathogen-specific features of MoeZ structure or regulation

    • Create cross-case analysis tables as described in search result to systematically compare findings across species

What interdisciplinary approaches could reveal new aspects of MoeZ biology?

Interdisciplinary approaches hold great potential for revealing new aspects of MoeZ biology:

  • Systems Biology Integration:

    • Construct comprehensive models of sulfur metabolism incorporating MoeZ

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Implement mathematical modeling to predict system behavior under perturbation

  • Evolutionary Biochemistry:

    • Reconstruct ancestral sequences of MoeZ and related proteins

    • Characterize the biochemical properties of these ancestral enzymes

    • Map the evolutionary trajectories that led to functional diversification

  • Chemical Biology:

    • Develop activity-based probes specific for MoeZ

    • Create small molecule inhibitors of MoeZ for chemical genetic studies

    • Design substrate analogs to probe the catalytic mechanism

  • Synthetic Biology Applications:

    • Engineer MoeZ variants with novel substrate specificities

    • Incorporate MoeZ into synthetic pathways for production of sulfur-containing metabolites

    • Develop MoeZ-based biosensors for detecting specific metabolites or conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.