Recombinant Probable calcium-binding mitochondrial carrier CBG00135 (CBG00135)

Shipped with Ice Packs
In Stock

Description

Genetic Information

The gene encoding CBG00135 has been identified and characterized in the C. briggsae genome. The protein is classified as a "Probable calcium-binding mitochondrial carrier," indicating that while its function has been predicted based on sequence homology and structural features, further experimental validation may be required to fully establish its physiological role . Interestingly, orthologous genes have been identified in other organisms, including rice (Oryza sativa), where it has been associated with quantitative trait loci (QTLs) for grain protein content .

Expression System and Methods

The recombinant form of CBG00135 has been successfully expressed in Escherichia coli expression systems with an N-terminal histidine tag to facilitate purification . This approach allows for the production of significant quantities of the protein for biochemical and functional studies. The expression of the full-length protein (amino acids 1-532) ensures that all functional domains remain intact, providing a representative model for studying the native protein's properties .

Role as a Mitochondrial Carrier

As a member of the mitochondrial carrier family, CBG00135 is likely involved in the transport of metabolites, nucleotides, and cofactors across the inner mitochondrial membrane . The specific substrates for CBG00135 have not been definitively established in the available literature, but its classification as a calcium-binding mitochondrial carrier suggests a role in calcium ion transport, which is critical for mitochondrial function and cellular energy metabolism.

Calcium-Binding Properties

The identification of CBG00135 as a calcium-binding protein suggests its involvement in calcium homeostasis within the mitochondria. Calcium signaling in mitochondria regulates various processes, including oxidative phosphorylation, mitochondrial dynamics, and apoptosis. The calcium-binding properties of CBG00135 may therefore be critical for coordinating mitochondrial function with cellular calcium signaling networks, although specific binding sites and affinities have not been detailed in the available research .

Role in QTL Studies for Grain Protein Content

One of the most significant research applications of CBG00135 has been in agricultural genomics, particularly in rice (Oryza sativa) breeding programs. Studies have identified a QTL (qSGPC2.1) associated with grain protein content that corresponds to a gene encoding a protein homologous to the calcium-binding mitochondrial carrier CBG00135 .

The QTL (qSGPC2.1) has been mapped to chromosome 2 in rice at position 5.66506 Mb and is characterized by a synonymous SNP within the gene . This QTL has demonstrated remarkable stability across different environments, as shown in the following table summarizing its characteristics:

EnvironmentChromosomePosition (Mb)LOD ScorePVE (%)SNP Type
Env. 125.665063.3166.703Synonymous, in gene
Env. 225.665063.52814.636Synonymous, in gene
MET-QTL25.6650584.4163.811Synonymous, in gene

The consistency of this QTL across environments (Env. 1 and Env. 2) with significant LOD scores (3.316 and 3.528) and phenotypic variance explained (6.703% and 14.636%) suggests that the CBG00135 homolog plays a substantial role in determining grain protein content in rice . Additionally, the multi-environment trial QTL (MET-QTL) analysis further confirms the stability of this genetic association.

Implications for Agricultural Research and Crop Improvement

The identification of CBG00135 as a genetic factor associated with grain protein content has significant implications for crop improvement strategies. Grain protein content is a critical determinant of nutritional quality in rice and other cereal crops, affecting both human nutrition and market value . The stable QTL associated with the CBG00135 homolog represents a potential target for marker-assisted selection in breeding programs aimed at enhancing protein content in rice varieties.

The high heritability of this trait (0.987 as indicated by the MET-QTL analysis) suggests that selection for favorable alleles of the CBG00135 homolog could lead to reliable improvements in grain protein content . This connection between a mitochondrial calcium-binding carrier and protein accumulation in grains provides an intriguing insight into the physiological pathways governing protein synthesis and deposition in developing seeds.

Exploring Homologs in Other Species

The identification of functional homologs of CBG00135 in rice and potentially other species suggests evolutionary conservation of this mitochondrial carrier. Comparative genomic studies across diverse organisms could reveal patterns of functional conservation and specialization, providing insights into the evolutionary history and biological importance of this protein family.

Applications in Crop Improvement

Further research on the rice homolog of CBG00135 and its association with grain protein content could lead to the development of improved molecular markers for breeding programs. Elucidating the molecular mechanisms by which this mitochondrial carrier influences protein accumulation in grains could also reveal novel targets for genetic engineering approaches to enhance crop nutritional quality.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CBG00135; Probable calcium-binding mitochondrial carrier CBG00135
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
CBG00135
Target Protein Sequence
MSVTVETPLQAGPLLKEKKQELIDIKNIQEHARTVQPFKASKHQPLISGSVSKEAAIATH AALHIDLTPEKEKKIREMYDRLDADNDGSIDIRDLTQALSSQTPHIPATMAPKLLAKMKR EDSDRVTYADFTNYVIAHEARLAEVFDQIDSNRDGEVDVSEIKSYCKEMGVNLDDHKALS IVKKMDQSGSSSVNLNEFQDFMLLYPSTDMREMVDFWRHNLIIDIGEDGQVPEDFTPQEL QSGVWWRHLVAGGVAGAMSRTCTAPFDRIKVYLQVNSTKTNKLGVVSCVHLLHAEGGLKS FWRGNGINVIKIAPESAMKFMSYDQIKRWIQEYKGGAELTTYERLFAGSSAGAISQTAIY PMEVMKTRLALRRTGQLDRGMIHFAHKMYDKEGIRCFYKGYLPNLLGIIPYAGIDLTVYE TLKSCYTQYYTEHTEPGVLALLACGTCSSTCGQLASYPLALVRTRLQARAISPKNSSQPD TMIGQFKHILQNEGFTGLYRGITPNFMKVIPAVSISYVVYEKVRKQLGATMS
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier.
Database Links

KEGG: cbr:CBG00135

STRING: 6238.CBG00135

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of CBG00135 and how does it compare to other calcium-binding mitochondrial carriers?

CBG00135 follows the characteristic organization of calcium-binding mitochondrial carriers with a protein length of approximately 500 amino acids. The structure consists of two distinct domains: a C-terminal mitochondrial carrier domain that facilitates metabolite transport across the inner mitochondrial membrane, and an N-terminal extension containing four EF-hand calcium-binding motifs with high similarity to calmodulin . This organization is consistent with other members of the SCaMC family, which share 70-80% sequence identity . The N-terminal calcium-binding domain faces the cytosolic side of the mitochondrial membrane, allowing these carriers to respond to changes in cytosolic calcium without requiring calcium entry into the mitochondria.

How can I determine the subcellular localization of CBG00135 in my experimental model?

To accurately determine the subcellular localization of CBG00135, a multi-method approach is recommended:

  • Immunofluorescence microscopy: Use CBG00135-specific antibodies along with established mitochondrial markers (e.g., MitoTracker) to visualize colocalization.

  • Subcellular fractionation: Isolate mitochondria, peroxisomes, and other cellular compartments using differential centrifugation followed by Western blotting.

  • Expression of tagged fusion proteins: Generate CBG00135-GFP fusion constructs for live-cell imaging.

It's important to note that while some homologous proteins were initially reported in peroxisomes (like rabbit Efinal protein), subsequent research demonstrated exclusive mitochondrial localization for this family of carriers . When designing localization experiments, include both N-terminal and C-terminal tags, as the N-terminal extension has been shown to be dispensable for correct mitochondrial targeting in related proteins .

What expression patterns of CBG00135 are observed across different tissues and developmental stages?

Based on studies of closely related calcium-binding mitochondrial carriers, CBG00135 likely exhibits tissue-specific and developmentally regulated expression patterns. Northern blot and Western blot analyses of similar carriers reveal predominant expression in liver and skeletal muscle . During development, expression levels typically increase from fetal to adult stages, particularly in the liver .

Tissue TypeRelative Expression Level
LiverHigh
Skeletal muscleHigh
HeartModerate
BrainLow to moderate
KidneyLow
LungVery low

For accurate expression profiling, employ quantitative RT-PCR with appropriately validated reference genes for different tissues and developmental stages. Complement this with protein-level analysis using specific antibodies against CBG00135.

How is CBG00135 regulated by hormones and other signaling molecules?

Studies on related calcium-binding mitochondrial carriers provide insights into potential regulatory mechanisms for CBG00135. The rat ortholog MCSC is significantly upregulated by dexamethasone treatment in pancreatic AR42J cells , suggesting glucocorticoid responsiveness. This upregulation occurs before albumin expression in dexamethasone-induced hepatocyte differentiation .

To investigate hormonal regulation:

  • Hormone treatment experiments: Treat appropriate cell lines with hormones of interest (glucocorticoids, thyroid hormones, sex steroids) and measure CBG00135 mRNA and protein levels.

  • Promoter analysis: Characterize the CBG00135 promoter region for potential hormone response elements.

  • Signaling pathway inhibitors: Use specific inhibitors to identify signaling pathways involved in CBG00135 regulation.

When designing these experiments, consider using a quasi-experimental design with untreated control groups and dependent pretest and posttest samples to establish causality between hormone treatment and expression changes .

What are the best experimental models for studying CBG00135 function?

Based on expression patterns of related carriers, the following experimental models are recommended:

  • Cell lines:

    • Hepatocyte cell lines (HepG2, Huh7) – high endogenous expression

    • Pancreatic AR42J cells – useful for studying differentiation-dependent expression

    • Skeletal muscle cell lines (C2C12) – high endogenous expression

  • Primary cells:

    • Primary hepatocytes – most physiologically relevant

    • Primary skeletal muscle cells

  • Animal models:

    • Liver-specific knockout/knockdown models

    • Skeletal muscle-specific knockout/knockdown models

When selecting an experimental model, consider using a quasi-experimental design that incorporates appropriate control groups . For interventional studies, an interrupted time-series design with multiple observations before and after intervention provides more robust evidence for causal relationships .

How do alternative splicing events affect the calcium sensitivity and transport activity of CBG00135?

Alternative splicing can significantly impact CBG00135 function. In the related SCaMC-2 gene, four variants generated by alternative splicing result in proteins with a common C-terminus but variations in their N-terminal halves, including the loss of one to three EF-hand motifs . These structural changes likely alter calcium sensitivity and, consequently, transport activity.

To investigate the functional consequences of alternative splicing:

  • Isoform-specific expression analysis: Use RT-PCR with isoform-specific primers to quantify expression patterns of different splice variants across tissues.

  • Recombinant protein production: Express and purify different splice variants for in vitro transport assays.

  • Calcium-binding assays: Compare calcium binding affinities of different isoforms using techniques such as isothermal titration calorimetry.

  • Electrophysiological measurements: Use reconstituted proteoliposomes or mitoplasts to measure transport activity at varying calcium concentrations.

Splice VariantEF-hand MotifsPredicted Ca²⁺ SensitivityPredominant Tissue Expression
Full-length4HighestLiver
Variant 23IntermediateSkeletal muscle
Variant 32LowVarious
Variant 41Very lowVarious

What is the relationship between cytosolic calcium oscillations and CBG00135-mediated transport activity?

CBG00135, like other calcium-binding mitochondrial carriers, likely transduces cytosolic calcium signals to modulate mitochondrial metabolism without requiring calcium entry into the organelle . To investigate this relationship:

  • Real-time imaging: Use FRET-based calcium sensors targeted to the cytosol and mitochondrial matrix to monitor calcium dynamics simultaneously with substrate transport.

  • Calcium clamping experiments: Use calcium ionophores and buffers to maintain specific cytosolic calcium concentrations while measuring transport activity.

  • Calcium oscillation patterns: Generate different patterns of calcium oscillations using optogenetic tools or receptor agonists to determine how frequency and amplitude affect transport.

  • Mutagenesis of EF-hand motifs: Systematically mutate calcium-binding sites to determine their individual contributions to transport regulation.

When designing these experiments, consider implementing a multiple-baseline interrupted time-series design to establish causality between calcium oscillations and transport activity changes .

How does CBG00135 interact with other mitochondrial proteins to regulate cellular metabolism?

As a mitochondrial carrier, CBG00135 likely participates in protein-protein interactions that modulate its function and integration into metabolic networks. To map these interactions:

  • Proximity labeling: Use BioID or APEX2 fusion proteins to identify proximal proteins in the native mitochondrial environment.

  • Co-immunoprecipitation: Isolate CBG00135 complexes under mild detergent conditions to preserve interactions.

  • Yeast two-hybrid screening: Identify direct protein interactors using the N-terminal domain as bait.

  • Cross-linking mass spectrometry: Capture transient interactions through chemical cross-linking followed by mass spectrometry.

These approaches should be complemented with functional validation through co-expression, knockdown, or mutagenesis studies to establish the physiological relevance of identified interactions.

What are the consequences of CBG00135 dysregulation in cellular stress conditions and disease models?

To investigate the role of CBG00135 in cellular stress responses and disease:

  • Oxidative stress: Expose cells to various oxidative stressors and monitor CBG00135 expression, localization, and activity.

  • Endoplasmic reticulum stress: Induce ER stress with tunicamycin or thapsigargin and assess effects on CBG00135.

  • Mitochondrial dysfunction: Use inhibitors of respiratory complexes to induce mitochondrial stress and evaluate CBG00135 response.

  • Disease models: Analyze CBG00135 expression in models of metabolic diseases, neurodegenerative disorders, and cancer.

For these studies, a quasi-experimental design using untreated control groups with pretest and posttest samples would provide the most robust evidence for causal relationships . Include measurements of mitochondrial function (membrane potential, respiratory capacity, ROS production) alongside CBG00135 analysis.

How does post-translational modification affect CBG00135 function and regulation?

Like other mitochondrial proteins, CBG00135 likely undergoes various post-translational modifications (PTMs) that regulate its activity, stability, and interactions. To characterize these PTMs:

  • Mass spectrometry-based PTM mapping: Identify phosphorylation, acetylation, ubiquitination, and other modifications using enrichment strategies coupled with high-resolution mass spectrometry.

  • Site-directed mutagenesis: Create non-modifiable mutants (e.g., S→A for phosphorylation sites) to assess functional consequences.

  • PTM-specific antibodies: Monitor dynamics of key modifications under different cellular conditions.

  • Pharmacological modulators: Use kinase/phosphatase inhibitors, deacetylase inhibitors, etc., to manipulate PTM status and assess functional outcomes.

When analyzing PTM data, consider using the one-group pretest-posttest design with a nonequivalent dependent variable approach to control for non-specific effects of treatments .

What are the optimal methods for recombinant expression and purification of CBG00135?

Recombinant expression of calcium-binding mitochondrial carriers presents several challenges due to their hydrophobic carrier domains and calcium-binding properties. The following approaches are recommended:

  • Expression systems:

    • E. coli: Use specialized strains (C41/C43) for membrane protein expression. Consider fusion with solubility-enhancing tags (MBP, SUMO).

    • Insect cells: Baculovirus expression system provides better folding environment for complex mammalian proteins.

    • Mammalian cells: HEK293 or CHO cells for expression with native post-translational modifications.

  • Purification strategy:

    • Two-step affinity purification using C-terminal and N-terminal tags

    • Detergent screening to identify optimal solubilization conditions

    • Size exclusion chromatography for final polishing and buffer exchange

  • Protein quality assessment:

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to assess stability

    • Calcium binding assays to confirm functionality

For expression of different domains, consider the following:

  • N-terminal calcium-binding domain: Express separately for structural studies

  • Full-length protein: Required for transport assays

When comparing expression methods, implement a quasi-experimental design with dependent pretest and posttest samples to evaluate protein yield and quality across different conditions .

How can I establish reliable assays to measure CBG00135 transport activity?

To characterize the transport function of CBG00135:

  • Reconstitution systems:

    • Proteoliposomes: Reconstitute purified protein into artificial liposomes

    • Liposome swelling assays: Monitor volume changes upon substrate transport

    • Fluorescence-based transport assays: Use fluorescent substrates or pH-sensitive dyes

  • Substrate identification:

    • Systematic screening of potential substrates

    • Competition assays to determine substrate specificity

    • Isotope-labeled substrate flux measurements

  • Calcium dependence characterization:

    • Transport measurements at defined calcium concentrations

    • Calcium titration curves to determine EC50 values

    • Kinetic parameters (Km, Vmax) determination at different calcium levels

Experimental MethodAdvantagesLimitationsBest For
ProteoliposomesDefined system, quantitativeTechnical complexityMechanistic studies
Isolated mitochondriaPhysiological contextBackground activityTissue-specific analysis
Permeabilized cellsIntact mitochondrial networkLimited substrate controlCellular context studies
Whole cells with sensorsIn vivo dynamicsIndirect measurementPhysiological regulation

When designing these assays, consider using a repeated-treatment design to establish reproducibility and evaluate the impact of different variables on transport activity .

What strategies are effective for gene silencing and overexpression studies of CBG00135?

For functional characterization through genetic manipulation:

  • RNA interference approaches:

    • siRNA: Transient knockdown with high efficiency

    • shRNA: Stable knockdown for long-term studies

    • Antisense oligonucleotides: Alternative for difficult-to-transfect cells

  • CRISPR-Cas9 genome editing:

    • Complete knockout: For loss-of-function studies

    • Knock-in mutations: To study specific domains or residues

    • CRISPRi: For tunable repression of expression

  • Overexpression systems:

    • Constitutive promoters: For consistent high-level expression

    • Inducible promoters (Tet-On/Off): For temporal control

    • Tissue-specific promoters: For spatial control in animal models

  • Rescue experiments:

    • Wild-type rescue of knockout/knockdown

    • Structure-function analysis with mutant variants

    • Isoform-specific complementation

When evaluating these approaches, implement a quasi-experimental design using control groups and pretests to establish baseline conditions before manipulation .

What imaging techniques can best visualize CBG00135 dynamics in living cells?

Advanced imaging approaches for studying CBG00135:

  • Fluorescent protein fusions:

    • CBG00135-GFP/mCherry for localization and dynamics

    • Split fluorescent protein complementation for interaction studies

    • Photoactivatable/photoswitchable fluorescent proteins for pulse-chase analysis

  • Super-resolution microscopy:

    • STED microscopy: For high-resolution localization within mitochondria

    • PALM/STORM: For single-molecule localization and dynamics

    • SIM: For whole-cell imaging with improved resolution

  • Dynamic imaging approaches:

    • FRAP (Fluorescence Recovery After Photobleaching): For mobility analysis

    • FLIP (Fluorescence Loss In Photobleaching): For continuity of compartments

    • Single-particle tracking: For detailed motion analysis

  • Functional imaging:

    • FRET sensors for calcium or metabolite detection

    • Simultaneous calcium and membrane potential imaging

    • Correlative light and electron microscopy

When comparing imaging methods, consider using an untreated control group design with dependent pretest and posttest samples to evaluate the impact of experimental conditions on protein dynamics .

How can I develop effective animal models to study CBG00135 function in vivo?

For in vivo functional studies:

  • Genetic models:

    • Conventional knockout: For systemic loss-of-function

    • Conditional knockout: For tissue-specific or inducible deletion

    • Knockin models: For studying specific mutations or tagged versions

  • Viral vector approaches:

    • AAV-mediated expression: For localized overexpression or rescue

    • Lentiviral shRNA delivery: For tissue-specific knockdown

    • CRISPR delivery: For in vivo genome editing

  • Physiological assessment:

    • Metabolic phenotyping: Respiratory exchange ratio, glucose tolerance

    • Tissue-specific functional tests: Liver function, muscle performance

    • Mitochondrial function analysis: Oxygen consumption, ATP production

  • Disease modeling:

    • Metabolic challenge models: High-fat diet, fasting/refeeding

    • Exercise protocols: For studying muscle adaptation

    • Drug-induced mitochondrial stress

When designing animal studies, implement an interrupted time-series design with multiple measurements before and after intervention to establish robust causal relationships .

How do I resolve discrepancies between localization studies of CBG00135 and related proteins?

Early studies suggested peroxisomal localization for some calcium-binding mitochondrial carriers, while later research demonstrated exclusive mitochondrial localization . To resolve such discrepancies:

  • Methodological analysis:

    • Evaluate antibody specificity through knockout/knockdown controls

    • Compare fixation and permeabilization methods that may affect epitope accessibility

    • Assess cross-reactivity with related family members

  • Multi-method approach:

    • Combine imaging with biochemical fractionation

    • Use orthogonal tagging strategies (N-terminal vs C-terminal tags)

    • Employ proximity labeling to identify neighboring proteins

  • Isoform-specific analysis:

    • Determine if different splice variants have distinct localizations

    • Consider cell type-specific factors that might influence localization

    • Evaluate developmental or condition-dependent changes in localization

What statistical approaches are appropriate for analyzing CBG00135 expression data across different experimental conditions?

For robust statistical analysis of expression data:

  • Descriptive statistics:

    • Calculate means, standard deviations, and confidence intervals

    • Generate box plots and histograms to visualize distributions

    • Assess normality using Shapiro-Wilk or Kolmogorov-Smirnov tests5

  • Inferential statistics:

    • For two-group comparisons: Student's t-test or Mann-Whitney U test

    • For multiple groups: ANOVA with appropriate post-hoc tests

    • For time-course data: Repeated measures ANOVA or mixed-effects models5

  • Correlation and regression analysis:

    • Pearson or Spearman correlation for relationship with cellular parameters

    • Linear regression to identify predictors of expression levels

    • Multiple regression for complex relationships5

  • Advanced approaches:

    • Principal component analysis for multivariate data

    • Cluster analysis for identifying expression patterns

    • Machine learning for predictive modeling

When designing statistical analyses, follow APA reporting standards and ensure transparency in data processing and statistical decision-making5.

How can I integrate proteomics, transcriptomics, and metabolomics data to understand the broader impact of CBG00135 function?

Multi-omics integration strategies:

  • Sequential analysis workflow:

    • Start with transcriptomics to identify expression changes

    • Follow with proteomics to confirm translation and identify PTMs

    • Complete with metabolomics to assess functional outcomes

  • Pathway-based integration:

    • Map all omics data to common metabolic pathways

    • Identify points of convergence suggesting key regulatory nodes

    • Perform pathway enrichment analysis across omics layers

  • Network analysis approaches:

    • Construct protein-protein interaction networks

    • Integrate metabolite-protein associations

    • Identify regulatory motifs and feedback loops

  • Computational integration:

    • Use multivariate statistical methods (OPLS-DA, O2PLS)

    • Apply machine learning for pattern recognition

    • Implement Bayesian networks for causal inference

When analyzing integrated datasets, consider using untreated control group design with dependent pretest and posttest samples to establish baseline variation before identifying treatment effects .

What are the key considerations when comparing CBG00135 with other calcium-binding mitochondrial carriers?

For comparative analysis:

  • Sequence and structural comparisons:

    • Multiple sequence alignment to identify conserved residues

    • Homology modeling based on available structures

    • Evolutionary analysis to trace functional divergence

  • Expression pattern comparison:

    • Tissue distribution profiles

    • Developmental regulation patterns

    • Response to common stimuli

  • Functional comparison:

    • Substrate specificity differences

    • Calcium sensitivity variations

    • Kinetic parameters (Km, Vmax)

  • Physiological context:

    • Tissue-specific roles

    • Contribution to specialized metabolic pathways

    • Compensation mechanisms in knockout models

CarrierPrimary SubstratesCa²⁺ Sensitivity (EC₅₀)Predominant TissuesKey Functional Domains
CBG00135[Based on homology][Estimated range]Liver, Muscle4 EF-hands, 6 TM domains
SCaMC-1ATP, ADP10-20 µMMultiple tissues4 EF-hands, 6 TM domains
SCaMC-2ATP, ADP1-10 µMLiver, Muscle4 EF-hands, 6 TM domains
Aralar1Aspartate, Glutamate0.3-0.5 µMBrain, Muscle8 EF-hands, 6 TM domains
CitrinAspartate, Glutamate1-3 µMLiver8 EF-hands, 6 TM domains

When conducting comparative analyses, implement a quasi-experimental design with switching replications to evaluate functional differences across different experimental conditions .

How do I interpret contradictory results on the physiological role of CBG00135 in different experimental systems?

When faced with contradictory results:

  • Systematic comparison of experimental conditions:

    • Cell type differences (immortalized vs. primary, species, tissue origin)

    • Expression levels (endogenous vs. overexpression)

    • Experimental timeframes (acute vs. chronic manipulations)

  • Mechanistic reconciliation approaches:

    • Identify conditional factors that modify protein function

    • Consider context-dependent protein interactions

    • Evaluate compensatory mechanisms in different systems

  • Technical validation:

    • Repeat key experiments using standardized protocols

    • Use multiple independent methods to test the same hypothesis

    • Validate reagents (antibodies, constructs) across systems

  • Meta-analysis framework:

    • Systematic review of published literature

    • Formal meta-analysis where sufficient quantitative data exists

    • Identify moderator variables that explain heterogeneity

When analyzing contradictory results, consider implementing the removed-treatment design to test whether effects are reversible or persistent across different experimental systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.