Recombinant Probable cardiolipin synthase 1 (crls-1)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

Crls-1 is implicated in cardiolipin biosynthesis, a phospholipid critical for mitochondrial membrane integrity. Its enzymatic activity involves:

  1. CL Synthesis: Transfers a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG), forming CL .

  2. Mitochondrial Regulation: Modulates mitochondrial morphology, biogenesis, and energy metabolism .

Key Experimental Observations

Study TypeFindingsSource
Enzymatic AssaysReduced CL levels and elevated PG in CRLS1-deficient cells
ThermogenesisOverexpression in adipocytes enhances uncoupled respiration and UCP1 expression
LipidomicsCRLS1 knockdown in macrophages alters CL acyl-chain composition

Research Applications and Experimental Models

Recombinant crls-1 is used to study mitochondrial dysfunction and lipid metabolism. Below are notable experimental approaches:

In Vitro and In Vivo Models

ModelMethodOutcomeSource
Patient FibroblastsLipid profiling of CL-deficient cells Reduced CL, altered acyl-chain composition
Mouse CardiomyocytesConditional Crls1 knockout (adipose-specific) Neonatal cardiac failure, disrupted cristae
MacrophagesLentiviral shRNA knockdown (Crls1 KD) Impaired inflammatory metabolic reprogramming

Diagnostic and Therapeutic Tools

ToolApplicationSource
AntibodiesWestern blot and flow cytometry detection (e.g., 84302-1-RR)
ELISA KitsQuantification of crls-1 protein levels

Clinical Implications

Deleterious variants in CRLS1 (human ortholog) are linked to mitochondrial encephalopathies with multi-systemic manifestations:

Clinical FeatureDescriptionSource
NeurologicalProgressive encephalopathy, congenital nystagmus, hearing loss
MetabolicDiabetes insipidus, autonomic instability, insulin resistance
CardiacDefects and early mortality in severe cases

Genetic and Lipid Profiling

  • Biallelic Variants: Autosomal recessive inheritance pattern .

  • Lipid Markers: Reduced CL, elevated PG, and altered acyl-chain composition in patient cells .

Comparative Analysis: Crls-1 vs. Human CRLS1

ParameterCrls-1 (C. elegans)Human CRLS1Source
UniProt IDO01916 Q9UJA2
AA Length246 301
Key FunctionCL synthesis, mitochondrial integrityThermogenesis, insulin sensitivity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crls-1; F23H11.9; Probable cardiolipin synthase; CMP-forming; CLS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
crls-1
Target Protein Sequence
MIVTSMFRGIACRCELQLLLTPRRMLRNFSSLEQKQSPKIESLPPEERGKYKVATIPNAI CTARIAATPLIGYLVVQHNFTPAFVLFTVAGATDLLDGFIARNVPGQKSLLGSVLDPVAD KLLISTMFITMTYAGLIPLPLTSVVILRDICLIGGGFYKRYQVMSPPYSLSRFFNPQVSS MQVVPTMMSKINTVLQITLVALSLSSPVFDFSTGANDVIVGLGCITGFTTIYSGLQYASG KAIKKI
Uniprot No.

Target Background

Function
This recombinant Probable cardiolipin synthase 1 (crls-1) catalyzes cardiolipin (CL) (diphosphatidylglycerol) synthesis by transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). Cardiolipin is a crucial mitochondrial membrane phospholipid, vital for maintaining mitochondrial integrity and function under both normal and stressful conditions.
Gene References Into Functions
  1. crls-1 knockdown in C. elegans body wall muscles leads to mitochondrial elongation, potentially due to phosphatidylglycerol accumulation rather than cardiolipin reduction. PMID: 29251771
Database Links
Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin Synthase 1 and what is its primary function in cellular metabolism?

Cardiolipin Synthase 1 (CRLS1) is an essential enzyme that catalyzes the final step in the biosynthesis of cardiolipin, a unique phospholipid predominantly found in mitochondrial membranes. The enzyme specifically functions by transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG), resulting in the formation of cardiolipin (diphosphatidylglycerol) . This reaction is critical for maintaining mitochondrial membrane integrity and function. Cardiolipin plays crucial roles in supporting the functional integrity and dynamics of mitochondria under both optimal and stress conditions . The enzyme is classified as a phosphatidyltransferase in eukaryotes, distinguishing it from prokaryotic cardiolipin synthases which belong to the phospholipase D superfamily .

Where is CRLS1 localized within cellular compartments and how does this localization relate to its function?

CRLS1 is primarily localized to the inner mitochondrial membrane as a multi-pass membrane protein . This specific subcellular localization directly aligns with its function in cardiolipin synthesis, as cardiolipin is a key component of mitochondrial membranes. The enzyme's positioning in the inner mitochondrial membrane enables it to access its substrates (phosphatidylglycerol and CDP-diacylglycerol) efficiently and contribute to the local production of cardiolipin where it is most needed . The enzyme's activity is influenced by the proton gradient across the inner mitochondrial membrane, with alkaline pH at the matrix side stimulating its activity . This localization is essential for coordinating cardiolipin synthesis with other mitochondrial processes and for maintaining the structural integrity of mitochondrial membranes.

How does the structure of CRLS1 compare between prokaryotes and eukaryotes?

Prokaryotic and eukaryotic CRLS1 enzymes differ significantly in their structure and catalytic mechanisms, despite catalyzing similar reactions. Eukaryotic cardiolipin synthases belong to the phosphatidyltransferase family, while bacterial cardiolipin synthases are members of the phospholipase D superfamily . In eukaryotes, CRLS1 catalyzes the transfer of an activated phosphatidyl group from phosphatidyl-CMP to phosphatidylglycerol, a reaction with considerable negative free energy change. In contrast, bacterial cardiolipin synthase catalyzes a near-equilibrium transphosphatidylation reaction between two phosphatidylglycerol molecules, with one acting as a phosphatidyl donor and the other as an acceptor . This fundamental difference in mechanism reflects evolutionary divergence in cardiolipin biosynthesis pathways. Despite these differences, eukaryotic CRLS1 enzymes from various species (human, rat, yeast, and Arabidopsis) share common characteristics such as high pH optima (pH 8-9) and requirements for specific divalent cations (Mg²⁺, Mn²⁺, or Co²⁺), suggesting they form a relatively homogeneous family .

What are the kinetic parameters of CRLS1 and how do they impact experimental design?

CRLS1 exhibits distinctive kinetic properties that significantly influence experimental design for studying this enzyme. A key characteristic is that the apparent Km value for phosphatidyl-CMP is approximately two orders of magnitude lower than the Km value for phosphatidylglycerol . This substantial difference in substrate affinity means that researchers must carefully consider substrate concentrations when designing enzyme activity assays. The enzyme also shows considerable specificity for phosphatidyl-CMP compared to other nucleotide analogs (adenosine, guanosine, and uridine) .

When designing experiments to measure CRLS1 activity, researchers should consider these parameters:

ParameterValue/CharacteristicExperimental Consideration
pH Optimum8-9Buffer systems should maintain alkaline conditions
Divalent Cation RequirementMg²⁺, Mn²⁺, or Co²⁺ (species-dependent)Include appropriate cations in reaction mixtures
Km for phosphatidyl-CMPMuch lower than for phosphatidylglycerolEnsure adequate concentrations of both substrates
Substrate SpecificityHigh for phosphatidyl-CMP; does not react with lysophosphatidylglycerolUse specific substrates; avoid substitutions
Detection Range (ELISA)0.78-50 ng/mLDilute samples appropriately to remain within this range
Sensitivity (ELISA)0.35 ng/mLConsider threshold when interpreting negative results

These parameters necessitate careful experimental design, particularly when measuring enzyme activity in complex biological samples .

How does substrate specificity influence CRLS1 activity in different cellular contexts?

The substrate specificity of CRLS1 has profound implications for its activity across different cellular contexts. Studies on human, rat, and Arabidopsis CRLS1 have established that the enzyme does not possess sufficient acyl specificity to explain the preferential synthesis of tetralinoleoyl-cardiolipin, which is the dominant molecular species in many animal and plant tissues . This finding indicates that post-synthetic remodeling, rather than initial synthesis, is responsible for the specific molecular composition of mature cardiolipin.

In mitochondria, CRLS1 shows considerable specificity for phosphatidyl-CMP compared to adenosine, guanosine, and uridine analogs, and it does not react when lysophosphatidylglycerol is supplied instead of phosphatidylglycerol . This substrate specificity means that the enzyme's activity is highly dependent on the availability of its specific substrates in different cellular environments. The reaction catalyzed by CRLS1 requires both phosphatidyl-CMP and phosphatidylglycerol, with their relative concentrations influencing reaction rates due to the significant difference in Km values between these substrates.

In various tissue types, CRLS1 expression and activity vary according to mitochondrial abundance, with highest expression in mitochondria-rich tissues such as heart, skeletal muscle, and liver . This tissue-specific variation suggests that CRLS1 activity is regulated in coordination with mitochondrial biogenesis and function, affecting the enzyme's role in different cellular contexts.

What methodological approaches are most effective for measuring CRLS1 enzyme activity in vitro?

Multiple methodological approaches can be employed to effectively measure CRLS1 enzyme activity in vitro, each with specific advantages depending on the research question:

  • ELISA-based detection: For quantifying CRLS1 protein levels, sandwich ELISA methods provide high sensitivity (0.35 ng/mL) and a detection range of 0.78-50 ng/mL . This approach is particularly valuable for measuring enzyme concentration rather than activity, serving as a complementary method to functional assays.

  • Radiolabeled substrate assays: Traditional enzyme activity measurements utilize radiolabeled substrates (³²P-labeled CDP-diacylglycerol or ¹⁴C-labeled phosphatidylglycerol) to track the formation of cardiolipin. After reaction completion, lipids are extracted and separated by thin-layer chromatography, with radiolabeled cardiolipin quantified via scintillation counting .

  • Isolated enzyme preparations: Studies with solubilized and partially purified enzyme preparations from rat liver, yeast, and Arabidopsis have been instrumental in characterizing intrinsic properties of CRLS1, such as pH optimum, cation requirements, and substrate preferences . This approach allows for detailed kinetic analyses while minimizing interference from other cellular components.

  • Reconstitution systems: For mechanistic studies, reconstitution of purified CRLS1 into liposomes of defined composition can help elucidate how membrane properties affect enzyme activity, particularly important since CRLS1 is a membrane-bound enzyme .

  • Mass spectrometry-based assays: Modern approaches utilize mass spectrometry to detect and quantify cardiolipin formation without radiolabeling, offering advantages in specificity and the ability to distinguish between different molecular species of cardiolipin produced.

For optimal results, reaction conditions should include appropriate buffers (pH 8-9), required divalent cations (Mg²⁺, Mn²⁺, or Co²⁺ depending on species origin), and carefully chosen substrate concentrations accounting for the vastly different Km values of the two substrates .

How are CRLS1 dysregulation and cardiolipin alterations implicated in mitochondrial diseases?

CRLS1 dysregulation and subsequent cardiolipin alterations have significant implications for mitochondrial diseases through multiple pathophysiological mechanisms. Cardiolipin, synthesized by CRLS1, is crucial for maintaining mitochondrial membrane integrity and function, and abnormalities in its synthesis or remodeling contribute to various disorders .

In Barth syndrome, a rare X-linked genetic disorder, mutations in the tafazzin gene disrupt cardiolipin remodeling, leading to abnormal cardiolipin composition . While CRLS1 itself is not mutated in Barth syndrome, the disorder highlights the critical importance of proper cardiolipin metabolism for mitochondrial function. Patients with Barth syndrome typically present with cardiomyopathy, skeletal myopathy, neutropenia, and growth retardation, demonstrating the systemic consequences of disturbed cardiolipin homeostasis .

CRLS1 dysregulation has also been implicated in metabolic disorders, including diabetes, where altered cardiolipin composition has been observed . These alterations may contribute to mitochondrial dysfunction, impaired energy metabolism, and increased oxidative stress, which are hallmarks of diabetic complications. Similarly, in cardiovascular diseases such as heart failure, disturbances in cardiolipin metabolism have been documented, potentially contributing to cardiomyocyte dysfunction .

Neurodegenerative diseases, including Parkinson's disease, have also been associated with cardiolipin abnormalities . These findings suggest that CRLS1-dependent cardiolipin synthesis and subsequent remodeling play crucial roles in maintaining neuronal mitochondrial function, with implications for neuroprotection and neurodegeneration.

Research approaches investigating these connections typically involve:

  • Analysis of cardiolipin species composition in patient samples or disease models

  • Assessment of CRLS1 expression and activity in affected tissues

  • Evaluation of mitochondrial function in the context of altered cardiolipin metabolism

  • Development of therapeutic strategies targeting cardiolipin synthesis or remodeling pathways

What experimental models are most suitable for studying CRLS1 function in different pathological conditions?

Selecting appropriate experimental models is crucial for investigating CRLS1 function in pathological conditions. Multiple model systems have proven valuable, each offering distinct advantages for specific research questions:

  • Cell Culture Models:

    • Cultured cells with CRLS1 knockdown or overexpression provide controllable systems for studying basic mechanisms

    • Patient-derived fibroblasts or induced pluripotent stem cells (iPSCs) offer clinically relevant platforms for investigating disease phenotypes

    • Cell lines with defects in cardiolipin metabolism (e.g., lymphoblasts from Barth syndrome patients) allow study of secondary effects on CRLS1 function

  • Yeast Models:

    • Saccharomyces cerevisiae with mutations in the CRLS1 ortholog has been instrumental in characterizing the consequences of defective cardiolipin synthesis

    • Yeast models have revealed regulatory mechanisms, including the influence of inositol on cardiolipin formation

    • The genetic tractability of yeast enables comprehensive analysis of genetic interactions with CRLS1

  • Drosophila Models:

    • Fruit flies with tafazzin mutations have demonstrated severe derangements in cardiolipin species patterns, providing insights into cardiolipin remodeling downstream of CRLS1

    • These models are particularly useful for studying developmental aspects of CRLS1 function

  • Rodent Models:

    • Mouse models with tissue-specific CRLS1 knockout or overexpression offer systemic perspectives on cardiolipin metabolism

    • Rat liver mitochondria have been extensively used for characterizing CRLS1 properties and regulation

    • Rodent models of diabetes, heart failure, and neurodegenerative diseases provide contexts for studying CRLS1 dysfunction in disease settings

  • Human Tissue Samples:

    • Analysis of tissues from patients with mitochondrial disorders, cardiovascular diseases, or metabolic conditions provides clinically relevant insights

    • Post-mortem brain tissue has been valuable for studying CRLS1 in neurodegenerative diseases

The selection of appropriate models should consider the specific pathological condition being studied, the research question at hand, and the availability of analytical techniques for assessing CRLS1 function and cardiolipin metabolism in the chosen model system.

How does CRLS1 expression respond to metabolic stress and what are the implications for therapeutic targeting?

CRLS1 expression and activity demonstrate dynamic responses to metabolic stress conditions, offering potential opportunities for therapeutic interventions. Several metabolic regulatory mechanisms influence CRLS1 function:

  • Hormonal Regulation: Thyroxin, an endocrine stimulator of mitochondrial biogenesis, increases cardiolipin concentration and CRLS1 activity . This response suggests that CRLS1 expression is controlled by transcriptional programs governing mitochondrial homeostasis. Therapeutically, modulating these hormonal pathways might enhance CRLS1 expression in conditions characterized by mitochondrial dysfunction.

  • Mitochondrial Biogenesis Factors: CRLS1 is most abundantly expressed in mitochondria-rich tissues such as heart, skeletal muscle, and liver . This tissue-specific expression pattern indicates that transcription factors regulating mitochondrial biogenesis likely control CRLS1 expression. The protein MIDAS (mitochondrial DNA absence sensitivity factor) increases mitochondrial mass by specifically upregulating mitochondrial lipids, including cardiolipin . Targeting such factors pharmacologically could potentially enhance cardiolipin synthesis in mitochondrial disorders.

  • Respiratory Chain Interaction: The assembly of respiratory complex IV affects CRLS1 activity , suggesting a feedback mechanism linking oxidative phosphorylation to cardiolipin synthesis. This interconnection implies that therapeutic strategies targeting respiratory chain function might indirectly influence CRLS1 activity.

  • Membrane Potential Sensitivity: The proton gradient across the inner mitochondrial membrane affects cardiolipin formation, possibly through stimulation of CRLS1 by alkaline pH at the matrix side . This mechanism links CRLS1 activity to mitochondrial energetics, suggesting that approaches maintaining mitochondrial membrane potential could support cardiolipin synthesis during metabolic stress.

  • Inositol Regulation: In yeast, inositol levels regulate cardiolipin formation , pointing to potential crosstalk between phospholipid metabolism pathways. Therapeutically, manipulating inositol metabolism might offer an indirect approach to modulating CRLS1 activity.

These regulatory mechanisms highlight the potential of CRLS1 as a therapeutic target in conditions characterized by mitochondrial dysfunction and altered cardiolipin metabolism, including metabolic disorders, neurodegenerative diseases, and cardiovascular conditions . Strategies may include enhancing CRLS1 expression, optimizing its enzymatic activity, or facilitating proper cardiolipin remodeling downstream of initial synthesis.

How does cardiolipin remodeling interact with de novo synthesis by CRLS1, and what are the implications for mitochondrial function?

The interplay between de novo cardiolipin synthesis by CRLS1 and subsequent remodeling represents a complex area of mitochondrial lipid metabolism with significant implications for mitochondrial function. This relationship involves several sophisticated mechanisms:

De novo cardiolipin synthesis by CRLS1 produces initial cardiolipin species that do not typically match the final molecular composition found in mature mitochondrial membranes . The enzyme lacks the necessary acyl specificity to explain the preferential synthesis of tetralinoleoyl-cardiolipin, which is the dominant molecular species in many animal and plant tissues . This discrepancy necessitates a post-synthetic remodeling process.

Cardiolipin remodeling occurs through multiple potential pathways, with tafazzin playing a central role. Unlike the traditional Lands cycle (deacylation by phospholipase A₂ followed by reacylation by acyl-CoA-dependent acyltransferase) used for remodeling other phospholipids, cardiolipin remodeling primarily employs transacylation reactions catalyzed by tafazzin . This process involves near-equilibrium chemical reactions rather than the two largely irreversible steps of the Lands cycle.

The functional significance of this interplay is manifold:

  • Structural Uniformity: Remodeling produces cardiolipin species with high structural uniformity and molecular symmetry, often resulting in a dominant form with four identical acyl chains . This uniformity may optimize cardiolipin's physical properties for mitochondrial membrane function.

  • Protein Interactions: Properly remodeled cardiolipin has specific interactions with mitochondrial proteins, particularly respiratory chain complexes and transport proteins. Crystal structure analyses have begun to reveal the principles underlying cardiolipin-protein interactions .

  • Membrane Dynamics: The combination of de novo synthesis and remodeling influences mitochondrial membrane properties, affecting processes such as fusion, fission, and cristae formation.

  • Pathophysiological Implications: Disturbances in either synthesis or remodeling can lead to pathological conditions. While CRLS1 mutations have not been widely reported in human diseases, defects in tafazzin cause Barth syndrome . Additionally, altered cardiolipin profiles are observed in diabetes, heart failure, and Parkinson's disease .

Research approaches to study this interplay include:

  • Isotope labeling to track de novo synthesis versus remodeling

  • Analysis of cardiolipin molecular species in various genetic backgrounds

  • Assessment of mitochondrial function in models with defects in synthesis versus remodeling

  • Structural studies of protein-cardiolipin interactions

Understanding this sophisticated interplay may lead to targeted therapeutic approaches for mitochondrial disorders by addressing specific defects in either synthesis or remodeling pathways.

What are the current technical challenges in producing and characterizing recombinant CRLS1 for structural studies?

Producing and characterizing recombinant CRLS1 for structural studies presents several significant technical challenges that researchers must address:

  • Membrane Protein Expression Issues:

    • As a multi-pass inner mitochondrial membrane protein , CRLS1 is inherently difficult to express in recombinant systems due to potential toxicity, misfolding, and aggregation

    • Expression systems must provide appropriate membrane environments for proper folding

    • Bacterial expression systems may lack the necessary machinery for eukaryotic membrane protein processing

  • Purification Complexities:

    • Extraction from membranes requires careful selection of detergents that maintain protein structure and function

    • Multiple purification steps often lead to significant loss of protein and activity

    • Previous studies have achieved only partial purification of CRLS1 from rat liver, yeast, and Arabidopsis expressed in E. coli

    • Maintaining enzyme stability throughout purification remains challenging

  • Structural Analysis Limitations:

    • Crystallization of membrane proteins is notoriously difficult

    • Detergent micelles used for solubilization can interfere with crystal formation

    • Alternative structural biology techniques like cryo-electron microscopy require highly pure, homogeneous samples

    • CRLS1's relatively small size (~27 kDa) may complicate cryo-EM analysis

  • Functional Reconstitution Challenges:

    • Verifying activity of purified recombinant CRLS1 requires reconstitution into artificial membrane systems

    • The lipid composition of reconstitution systems significantly affects enzyme activity

    • Ensuring proper orientation in liposomes is critical but technically difficult to control

  • Substrate Preparation Difficulties:

    • Enzymatic assays require synthesis of specific substrates including phosphatidyl-CMP and defined species of phosphatidylglycerol

    • These substrates are not commercially available and must be synthesized

    • Their amphipathic nature complicates handling and incorporation into assay systems

Potential solutions being implemented by researchers include:

  • Use of specialized expression systems for membrane proteins (insect cells, yeast)

  • Development of fusion constructs to enhance solubility

  • Application of lipid nanodiscs for stabilization and functional studies

  • Implementation of detergent screens to identify optimal extraction conditions

  • Employment of advanced structural techniques like hydrogen-deuterium exchange mass spectrometry that can work with partially purified samples

Progress in addressing these challenges will be crucial for understanding CRLS1's structure-function relationships and developing targeted therapeutic approaches for conditions involving cardiolipin metabolism.

How do contradictory findings on CRLS1 substrate specificity impact our understanding of cardiolipin biogenesis?

Contradictory findings regarding CRLS1 substrate specificity have created a nuanced and complex picture of cardiolipin biogenesis, challenging researchers to reconcile disparate observations. These contradictions primarily center around the enzyme's acyl chain specificity and its implications for the final cardiolipin composition in mitochondrial membranes.

The most significant contradiction relates to the observed molecular uniformity of cardiolipin in tissues versus the apparent lack of acyl specificity in CRLS1 enzymatic activity. Studies on human, rat, and Arabidopsis CRLS1 have clearly established that the enzyme does not possess sufficient acyl specificity to explain the preferential synthesis of tetralinoleoyl-cardiolipin, which is the dominant molecular species in many animal and plant tissues . This contradiction forced a paradigm shift in understanding cardiolipin biosynthesis, leading to the recognition that post-synthetic remodeling, rather than initial synthesis, is responsible for the specific molecular composition of mature cardiolipin.

Another area of contradiction involves the substrate preferences of CRLS1 across species. While the enzymes from rat, yeast, and Arabidopsis all require divalent cations, the specific cation with the highest stimulatory effect appears different for each: Co²⁺ for rat, Mg²⁺ for yeast, and Mn²⁺ for Arabidopsis enzymes . These differences raise questions about the evolutionary conservation of the enzyme's catalytic mechanism and whether these represent true species differences or methodological variations.

The contradictions in CRLS1 substrate specificity have significant implications:

  • Research Approach Re-orientation: The field has shifted from focusing solely on de novo synthesis to emphasizing the integrated pathway including both synthesis and remodeling.

  • Methodological Considerations: Researchers must carefully consider experimental conditions when measuring CRLS1 activity, including appropriate cations, substrate preparations, and assay conditions.

  • Therapeutic Target Selection: The contradictions suggest that targeting cardiolipin remodeling enzymes like tafazzin may be more effective than targeting CRLS1 itself for disorders involving abnormal cardiolipin composition.

  • Evolutionary Biology Insights: The species-specific differences suggest potential evolutionary adaptations in cardiolipin metabolism across phylogeny.

  • Systems Biology Approach Necessity: Understanding cardiolipin biogenesis now requires integrating multiple enzymatic activities beyond CRLS1, including tafazzin and potentially other acyltransferases and phospholipases .

These contradictions have ultimately enriched our understanding of cardiolipin biogenesis, moving from a simple linear pathway to a complex, integrated system involving multiple enzymes and regulatory mechanisms. This complexity better explains how cells achieve and maintain the specific cardiolipin composition required for optimal mitochondrial function across different tissues and physiological states.

What are the most sensitive and specific methods for detecting and quantifying CRLS1 in different sample types?

Researchers have developed several complementary methods for detecting and quantifying CRLS1 in various sample types, each with distinct advantages depending on the research question and available materials:

  • Enzyme-Linked Immunosorbent Assay (ELISA):

    • Sandwich ELISA methods offer high sensitivity (0.35 ng/mL) and specificity for human CRLS1

    • Detection range of 0.78-50 ng/mL allows quantification in various sample types

    • Applicable to serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids

    • Provides reliable quantitative data with low intra-assay (4.5%) and inter-assay (9.1%) coefficients of variation

  • Western Blotting:

    • Allows visualization of CRLS1 protein expression and semi-quantitative analysis

    • Can distinguish between different protein forms or post-translational modifications

    • Requires specific antibodies against CRLS1, with sensitivity dependent on antibody quality

    • Particularly useful for comparing relative expression levels across different samples

  • Quantitative PCR (qPCR):

    • Measures CRLS1 mRNA expression rather than protein levels

    • Highly sensitive method for detecting changes in gene expression

    • Requires careful primer design and validation to ensure specificity

    • Enables analysis of transcriptional regulation of CRLS1 in different physiological and pathological states

  • Enzymatic Activity Assays:

    • Directly measure functional CRLS1 activity rather than protein abundance

    • Typically involve monitoring the formation of cardiolipin from phosphatidylglycerol and CDP-diacylglycerol

    • Can be coupled with thin-layer chromatography or mass spectrometry for product identification

    • Provide functional data that complement protein quantification methods

  • Mass Spectrometry-Based Proteomics:

    • Allows absolute quantification of CRLS1 protein using labeled peptide standards

    • Can detect post-translational modifications and protein interactions

    • Particularly valuable for complex samples where antibody specificity may be limiting

    • Enables global analysis of mitochondrial proteins alongside CRLS1

Sample preparation considerations for different specimen types:

Sample TypeRecommended PreparationSpecial Considerations
TissueMitochondrial isolation followed by gentle solubilizationPreserve enzyme activity by avoiding harsh detergents
Cell CultureDifferential centrifugation for mitochondrial enrichmentConsider cell type-specific expression levels
Body FluidsDirect application to ELISA with appropriate dilutionControl for matrix effects in complex fluids
Recombinant ProteinCareful selection of detergents for membrane proteinMaintain lipid environment for functional studies

The choice of method depends on the specific research question, with ELISA providing the most straightforward quantification, activity assays offering functional insights, and more advanced techniques like mass spectrometry enabling deeper proteomic analysis .

What are the key considerations in designing experiments to investigate CRLS1 regulation in mitochondrial disease models?

Designing experiments to investigate CRLS1 regulation in mitochondrial disease models requires careful consideration of multiple factors to ensure valid and interpretable results. Key considerations include:

  • Model System Selection:

    • Match the model to the specific mitochondrial disease being studied (e.g., patient-derived cells for Barth syndrome, animal models for broader mitochondrial disorders)

    • Consider tissue specificity, as CRLS1 expression varies significantly among tissues, with highest levels in heart, skeletal muscle, and liver

    • Evaluate both cellular and organismal models to capture systemic effects of mitochondrial dysfunction

    • Account for species differences in CRLS1 properties, such as cation preferences (Co²⁺ for rat, Mg²⁺ for yeast, Mn²⁺ for Arabidopsis)

  • Experimental Conditions:

    • Control for mitochondrial content when comparing between samples, as CRLS1 expression correlates with mitochondrial abundance

    • Consider the influence of culture conditions on mitochondrial function (oxygen levels, substrate availability, confluency)

    • Account for the proton gradient effect on CRLS1 activity, as alkaline pH at the matrix side stimulates the enzyme

    • Include relevant physiological stressors that may affect CRLS1 regulation (e.g., metabolic stress, oxidative stress)

  • Technical Approaches:

    • Combine multiple methodologies to assess different aspects of CRLS1 regulation:

      • Transcriptional regulation: qPCR, reporter assays

      • Protein expression: Western blotting, ELISA

      • Enzymatic activity: Functional assays with appropriate substrates

      • Cardiolipin analysis: Mass spectrometry to assess product formation

    • Include appropriate controls for each technique and validate findings through complementary approaches

  • Regulatory Pathway Analysis:

    • Investigate known regulatory mechanisms of CRLS1, including:

      • Response to thyroxin, which stimulates mitochondrial biogenesis

      • Interaction with MIDAS protein, which upregulates mitochondrial lipids

      • Relationship to respiratory complex IV assembly

      • Effects of the mitochondrial membrane potential

      • Regulation by inositol (particularly in yeast models)

    • Consider potential crosstalk between cardiolipin synthesis and remodeling pathways

  • Data Integration and Interpretation:

    • Correlate CRLS1 regulation with functional mitochondrial outcomes (respiration, membrane potential, ROS production)

    • Analyze cardiolipin species composition to assess the relationship between CRLS1 activity and downstream remodeling

    • Consider compensatory mechanisms that may mask primary defects in CRLS1 regulation

    • Integrate findings with clinical data when using patient-derived samples

By addressing these considerations, researchers can design robust experiments that provide meaningful insights into CRLS1 regulation in mitochondrial disease contexts, potentially identifying therapeutic targets and advancing our understanding of mitochondrial lipid metabolism in health and disease.

How can researchers effectively combine in vitro and in vivo approaches to study CRLS1 function in complex biological systems?

Effectively combining in vitro and in vivo approaches creates a powerful research strategy for comprehensively understanding CRLS1 function in complex biological systems. This integrated approach allows researchers to connect molecular mechanisms to physiological outcomes while overcoming the limitations inherent to each method individually.

Methodological Integration Examples:

  • Structure-Function Relationships:

    • In vitro: Use purified recombinant CRLS1 to identify critical catalytic residues through site-directed mutagenesis

    • Cell culture: Express mutant forms in CRLS1-deficient cells to assess functional consequences

    • In vivo: Generate knock-in animal models with specific mutations to evaluate physiological impact

    • Human samples: Screen for natural variants in identified critical residues in patients with mitochondrial disorders

  • Regulatory Mechanisms:

    • In vitro: Identify potential regulators of CRLS1 activity using purified components

    • Cell culture: Manipulate these regulators genetically or pharmacologically and assess effects on CRLS1

    • In vivo: Evaluate tissue-specific differences in regulatory mechanisms using animal models

    • This multi-level approach can reveal context-dependent regulation, as observed with cation preferences across species

  • Disease Modeling:

    • In vitro: Characterize enzymatic defects using recombinant mutant proteins

    • Patient-derived cells: Assess cellular consequences of identified defects

    • Animal models: Evaluate systemic manifestations and test intervention strategies

    • Clinical samples: Correlate biochemical findings with disease severity and progression

By strategically combining these approaches, researchers can develop a comprehensive understanding of CRLS1 function that spans from molecular mechanisms to physiological significance, ultimately contributing to the development of targeted interventions for disorders involving cardiolipin metabolism disturbances.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.