Recombinant Probable cation-transporting P-type ATPase C (ctpC)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant CtpC refers to the Mycobacterium leprae-derived protein (UniProt ID: Q9CCL1) expressed in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetail
SpeciesMycobacterium leprae
Expression HostE. coli
TagN-terminal His tag
Protein Length725 amino acids (Full-length)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)

This recombinant form retains functional motifs essential for Mn²⁺ transport, including transmembrane helices (M1–M10) and cytoplasmic domains (A, P, N) .

Biochemical Characterization

CtpC exhibits Mn²⁺-dependent ATPase activity with distinct kinetic properties :

ParameterValue (CtpC)Comparison (Cu⁺-ATPase CopA)
Vmax2.29 nmol/mg·min27.3 nmol/mg·min¹
Km (Mn²⁺)0.19 µM0.6 µM²
Activation EnergyHigh (~22–25 kcal/mol)Similar to SERCA ATPases³

¹E. coli CopA ; ²ATP7A ; ³SERCA .

The enzyme’s low turnover (Vmax) and high substrate affinity suggest a role in precise Mn²⁺ delivery to metalloproteins rather than bulk efflux .

Functional Role in Pathogenesis

CtpC is essential for:

  • Mn²⁺ Homeostasis: Exporting excess Mn²⁺ to prevent cytoplasmic toxicity .

  • Metalloprotein Assembly: Delivering Mn²⁺ to superoxide dismutase (SOD), enhancing oxidative stress resistance .

  • Virulence: M. tuberculosis ctpC mutants show attenuated growth in macrophages and mice, linking Mn²⁺ handling to pathogenicity .

Research Applications

Recombinant CtpC enables:

  • Mechanistic Studies: Investigating ATPase conformational changes via X-ray crystallography and SFX .

  • Drug Development: Targeting Mn²⁺ transport pathways to disrupt bacterial metal homeostasis .

  • Enzyme Engineering: Modifying metal-binding residues to alter substrate specificity .

Key Research Findings

  • Substrate Specificity: CtpC transports Mn²⁺ but not Zn²⁺ or Cu⁺, despite earlier hypotheses .

  • Redox Sensitivity: ctpC mutants exhibit increased susceptibility to H₂O₂, underscoring Mn-SOD dependence .

  • Structural Insights: The N-terminal metal-binding domain regulates ATPase activity by interacting with cytoplasmic domains .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctpC; mtaA; BQ2027_MB3298; Manganese-exporting P-type ATPase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-718
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
ctpC
Target Protein Sequence
MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTGSVVVWYSPRR ADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMVIGGVALALLGVRRYVFARPP LLGTTGRTVATGVTIFTGYPFLRGALRSLRSGKAGTDALVSAATVASLILRENVVALTVL WLLNIGEYLQDLTLRRTRRAISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVQIGD EVVVHEHVAIPVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLITGDVRRAMTML LIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAGRVDAIVFDKTGTLTVGRPVV TNIVAMHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRISIPPHEECEVLVGLGMR TWADGRTLLLGSPSLLRAEKVRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEV RPEAAQVLTKLRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD DGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHRLLDVGDLGER AVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNASSVAVVANSSRLIRYRLDR
Uniprot No.

Target Background

Function
High affinity, slow turnover Mn(2+) transporting ATPase.
Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary relationship between ctpC and other Ctp proteins?

Phylogenetic analysis reveals that ctpC belongs to a family of proteins that includes ctpA and ctpB, with ctpA having diverged early from both ctpB and ctpC during evolution. This early divergence implies that these proteins have developed distinct roles in photosynthetic organisms over time . While sharing structural similarities as members of the cation-transporting P-type ATPase family, each protein has evolved specialized functions, with ctpC likely developing unique substrate specificity or regulatory mechanisms compared to its counterparts.

The divergence pattern suggests that researchers should consider ctpC's evolutionary context when studying its function, as its role may vary significantly across different photosynthetic organisms due to species-specific adaptations. Understanding this evolutionary relationship provides critical context for experimental design and interpretation of functional studies.

How do ctpC expression patterns compare across different model organisms?

Expression patterns of ctpC vary across photosynthetic organisms, including higher plants like Arabidopsis thaliana, mosses such as Physcomitrella patens (P. patens), algae like Chlamydomonas reinhardtii (C. reinhardtii), and cyanobacteria including Synechococcus elongatus PCC 7942 . Research indicates that expression levels and tissue distribution differ significantly between species, reflecting evolutionary adaptations to specific ecological niches.

In experimental approaches, researchers often use transgenic lines expressing recombinant forms of these proteins tagged with epitopes (such as HA tags) to facilitate detection and localization studies. For instance, experimental work has demonstrated that AtCtpC (Arabidopsis thaliana ctpC) can be studied using constructs where the coding sequence is fused with a C-terminal 2x HA tag and expressed under the control of the CaMV 35S promoter .

What cellular compartments contain functional ctpC protein?

The subcellular localization of ctpC is critical for understanding its function. In photosynthetic eukaryotes, ctpC contains an N-terminal chloroplastic transit peptide that directs the protein to the chloroplast . Within chloroplasts, ctpC may be distributed across different sub-compartments including the stroma, thylakoid membrane, and thylakoid lumen.

To determine the precise localization, researchers typically employ cellular fractionation techniques followed by immunoblotting analysis. This methodological approach involves:

  • Isolation of intact chloroplasts from transgenic plants

  • Fractionation into stroma, thylakoid membrane, and thylakoid lumen

  • Detection of ctpC using specific antibodies (e.g., anti-HA for tagged versions)

  • Comparison with known compartment-specific marker proteins (such as PC for lumen, D1 for membrane, and ClpC for stroma)

Understanding the subcellular localization provides insights into potential interaction partners and functional roles of ctpC within the photosynthetic machinery.

What are the optimal experimental designs for evaluating ctpC activity?

When studying ctpC activity, researchers should consider implementing Central Composite Design (CCD) approaches to systematically evaluate multiple factors that might influence protein function. CCD represents a robust experimental design for response surface methodology that allows researchers to model curved or non-linear relationships between experimental factors and measured responses .

For ctpC activity studies, a central composite design would typically:

  • Begin with a factorial or fractional factorial design with center points

  • Add "star points" to estimate curvature in the response

  • Allow systematic evaluation of factors such as pH, temperature, substrate concentration, and cofactor requirements

The precise implementation depends on the number of factors being investigated. For a design with k factors, there will be 2k star points representing new extreme values for each factor . Three main varieties of CCD can be employed:

CCD TypeStar Point PlacementSpace ExplorationRotatability
CCC (Circumscribed)Outside factorial pointsLargest spaceRotatable
CCI (Inscribed)At factorial pointsSmallest spaceRotatable
CCF (Face-centered)On faces of factorial spaceIntermediateNon-rotatable

Implementing such designs allows for methodical assessment of ctpC activity across a range of conditions, enabling researchers to identify optimal parameters and understand complex interactions between factors affecting enzymatic function .

How can recombinant ctpC be expressed and purified for in vitro studies?

Expression and purification of recombinant ctpC present specific challenges that require methodological consideration. Based on approaches used for related Ctp proteins, researchers typically employ bacterial expression systems with fusion tags to facilitate purification.

A standard protocol would include:

  • Construct preparation: Clone the ctpC coding sequence (without the chloroplast transit peptide for better expression) into a bacterial expression vector with an N-terminal GST or His tag

  • Expression optimization: Test multiple expression conditions in E. coli strains such as BL21(DE3) with variations in temperature (16-37°C), induction time, and IPTG concentration

  • Purification strategy: Use affinity chromatography followed by size exclusion chromatography

  • Activity preservation: Include appropriate cofactors and maintain pH stability throughout purification

What assays are available for measuring ctpC enzymatic activity?

To assess ctpC enzymatic activity, researchers can adapt assays developed for related Ctp proteins. These typically involve monitoring the processing of specific substrates using gel-based or spectroscopic techniques.

A comprehensive enzymatic characterization would include:

  • Substrate preparation: Either native substrates isolated from biological samples or recombinant substrates expressed and purified from bacterial systems

  • Reaction conditions optimization: Testing activity across a range of pH values (typically pH 6-9), temperatures, and buffer compositions

  • Time-course analysis: Monitoring substrate conversion over time (e.g., 10, 20, 40, 60 minutes)

  • Product detection: Using immunoblotting with specific antibodies or SDS-PAGE with protein staining

  • Quantification: Determining reaction rates through densitometric analysis of protein bands

For instance, when studying Arabidopsis ctpA, researchers assessed activity using both native pD1 substrate (obtained from detergent-treated thylakoid membranes) and recombinant pD1 substrate. Similar approaches could be adapted for ctpC functional studies .

How should researchers analyze comparative activity data across different ctpC orthologs?

When comparing ctpC activity across different species, researchers should employ a systematic analytical approach that accounts for evolutionary relationships and experimental variables. Based on studies of related Ctp proteins, significant variations in activity can be observed across different orthologs even when tested against the same substrate.

A methodological approach to comparative analysis includes:

  • Standardization of protein quantities and substrate concentrations across all tested orthologs

  • Normalization of activity data relative to a reference ortholog

  • Time course experiments to determine initial reaction rates

  • Statistical analysis of replicate experiments (minimum n=3)

  • Correlation of activity differences with protein sequence divergence

For example, in studies comparing CtpA from different photosynthetic organisms against Arabidopsis pD1 substrate, a clear activity hierarchy was observed: AtCtpA > PpCtpA > CrCtpA > SeCtpA . Similar comparative approaches would be valuable for ctpC research, providing insights into evolutionary functional specialization.

What statistical models are appropriate for analyzing ctpC response to multiple experimental factors?

When analyzing ctpC responses to multiple experimental factors, researchers should implement response surface methodology (RSM) statistical approaches that can model complex, non-linear relationships. Central Composite Designs (CCD) as described earlier provide the experimental framework, while the following statistical models support rigorous analysis:

  • Second-order polynomial models: These can capture quadratic effects and two-factor interactions:

    Y=β0+βiXi+βiiXi2+βijXiXj+εY = β₀ + ∑βᵢXᵢ + ∑βᵢᵢXᵢ² + ∑βᵢⱼXᵢXⱼ + ε

  • Analysis of variance (ANOVA): For testing significance of model terms

  • Lack-of-fit testing: To evaluate model adequacy

  • Response surface visualization: Through contour plots and 3D surface plots to identify optimal conditions

Such statistical approaches allow researchers to identify critical factors affecting ctpC function, optimal conditions for activity, and interactions between experimental variables that might not be apparent from simple one-factor-at-a-time experiments .

How can researchers differentiate between direct ctpC effects and indirect cellular responses?

Distinguishing direct ctpC effects from indirect cellular responses requires complementary experimental approaches. This represents a common challenge in protein research where knockout or overexpression can trigger compensatory mechanisms.

Methodological strategies include:

  • In vitro versus in vivo comparisons: Testing purified recombinant ctpC activity in controlled conditions alongside cellular experimental systems

  • Mutant complementation studies: Using transgenic expression of ctpC in knockout mutant backgrounds to confirm direct function, as demonstrated in studies with related proteins

  • Dose-response relationships: Establishing whether cellular effects scale proportionally with ctpC expression or activity levels

  • Temporal analysis: Determining whether observed effects occur immediately following ctpC activation or after a delay suggesting indirect mechanisms

  • Specific inhibitor studies: When available, using selective inhibitors to block ctpC activity without affecting related proteins

These approaches collectively provide stronger evidence for direct ctpC functions versus indirect or compensatory effects that might emerge in complex biological systems.

How does ctpC function relate to environmental adaptation in photosynthetic organisms?

The functional role of ctpC in environmental adaptation represents an emerging research area. Given its evolutionary divergence from ctpA and ctpB , ctpC may contribute to specialized adaptation mechanisms in photosynthetic organisms facing different environmental challenges.

Research approaches to investigate this relationship include:

  • Comparative genomics: Analyzing ctpC sequence conservation and variation across species from diverse ecological niches

  • Expression profiling: Examining ctpC expression changes under various environmental stressors (temperature, light intensity, salinity, drought)

  • Phenotypic characterization: Evaluating ctpC mutant or overexpression lines under controlled stress conditions

  • Protein interaction studies: Identifying stress-specific interaction partners using techniques such as co-immunoprecipitation or yeast two-hybrid screens

Understanding ctpC's role in environmental adaptation could provide insights into evolutionary mechanisms and potential biotechnological applications for improving stress tolerance in photosynthetic organisms.

What techniques are most effective for studying protein-protein interactions involving ctpC?

Investigating protein-protein interactions is critical for understanding ctpC function within cellular networks. Several complementary techniques can be employed:

  • Co-immunoprecipitation (Co-IP): Using tagged versions of ctpC (e.g., HA-tagged constructs) to pull down interacting partners from plant extracts, followed by mass spectrometry identification

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in living cells by fusing potential interacting partners with complementary fragments of a fluorescent protein

  • Yeast Two-Hybrid (Y2H) screening: To identify novel interaction partners from cDNA libraries

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified ctpC and candidate interacting proteins

  • Blue Native PAGE (BN-PAGE): To analyze protein complex formation, as demonstrated in studies of related proteins where thylakoid membrane protein complexes were examined

These approaches should be combined for robust verification of interactions, as each technique has specific strengths and limitations regarding sensitivity, specificity, and cellular context.

What are the key considerations when designing CRISPR/Cas9 approaches for ctpC functional studies?

CRISPR/Cas9 genome editing provides powerful tools for ctpC functional studies, but requires careful design considerations specific to this protein:

  • Guide RNA design: Target regions should be:

    • Specific to ctpC without off-target effects on related genes like ctpA and ctpB

    • Avoid conserved catalytic domains if point mutations rather than knockouts are desired

    • Consider targeting regulatory regions for expression modulation rather than coding sequence disruption

  • Knockout strategy: Complete knockout may be lethal if ctpC is essential; consider:

    • Conditional knockout systems (inducible promoters)

    • Tissue-specific promoters for spatially restricted editing

    • Partial loss-of-function mutations in functional domains

  • HDR template design: For precise mutations or tagging:

    • Include fluorescent or epitope tags that don't interfere with localization signals

    • Consider silent mutations that preserve protein function but enable tracking

    • Include selection markers for efficient identification of edited cells

  • Phenotypic validation: Confirm that observed phenotypes result from ctpC modification by:

    • Complementation studies with wild-type ctpC

    • Testing multiple independent edited lines

    • Quantitative analysis of protein expression and activity levels

These considerations ensure that CRISPR/Cas9 approaches yield interpretable results for understanding ctpC function in photosynthetic organisms.

How does post-translational regulation affect ctpC activity in different cellular conditions?

Post-translational regulation likely plays a crucial role in modulating ctpC activity in response to changing cellular conditions. Research into this area should consider multiple regulatory mechanisms:

  • Phosphorylation: Identification of potential phosphorylation sites using bioinformatic prediction followed by phosphoproteomic analysis

  • Redox regulation: Investigation of cysteine residues that might undergo oxidation/reduction in different light conditions or stress responses

  • Proteolytic processing: Analysis of potential processing events beyond the initial transit peptide cleavage, similar to processing observed in related proteins

  • Protein-protein interactions: Identification of regulatory binding partners that might inhibit or enhance ctpC activity

  • Subcellular relocalization: Examination of potential movement between sub-chloroplast compartments under different conditions

Methodological approaches should combine in vitro biochemical assays with cellular studies under varied conditions to understand how post-translational modifications affect ctpC function in physiologically relevant contexts.

What transcriptomic approaches best reveal ctpC expression patterns across different tissues and conditions?

Modern transcriptomic approaches offer powerful tools for understanding ctpC expression patterns. Based on methodologies developed for other systems, researchers should consider:

  • RNA-Seq analysis: Provides comprehensive transcriptome-wide view of expression changes, allowing identification of co-regulated genes

  • Single-cell RNA-Seq: Reveals cell-type specific expression patterns within complex tissues

  • Time-course experiments: Capture dynamic expression changes in response to developmental cues or environmental stimuli

  • Comparative transcriptomics: Analysis across related species to identify conserved expression patterns

How can structural biology approaches inform the development of specific ctpC modulators?

Understanding ctpC structure is essential for developing specific modulators (activators or inhibitors). Researchers should implement complementary structural biology approaches:

  • Homology modeling: Using structures of related P-type ATPases as templates to predict ctpC structure

  • X-ray crystallography: For high-resolution structural determination of purified ctpC, potentially in complex with substrates or inhibitors

  • Cryo-electron microscopy: Particularly valuable for examining ctpC within larger membrane-associated complexes

  • Molecular dynamics simulations: To study conformational changes associated with the catalytic cycle

  • Structure-guided mutagenesis: To validate structural predictions and identify critical functional residues

These approaches can inform rational design of specific modulators that target unique structural features of ctpC without affecting related proteins like ctpA and ctpB. Such modulators would serve as valuable research tools and potentially lead to biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.