Recombinant Probable cation-transporting P-type ATPase D (ctpD)

What is Probable cation-transporting P-type ATPase D (ctpD) and what organism does it originate from?

Probable cation-transporting P-type ATPase D (ctpD) is a membrane transport protein that belongs to the P-type ATPase family, which utilizes ATP hydrolysis to transport cations across biological membranes. The specific variant referenced in the research literature is derived from Mycobacterium bovis, containing 657 amino acids in its full-length form . P-type ATPases are characterized by the formation of a phosphorylated intermediate during their catalytic cycle, with ctpD specifically believed to be involved in cobalt or nickel ion export based on its sequence homology and functional characteristics.

What are the general structural features of ctpD protein?

The full-length ctpD protein (P63686) consists of 657 amino acids with multiple transmembrane domains characteristic of P-type ATPases. Its primary sequence reveals hydrophobic regions consistent with membrane-spanning segments and conserved domains typical of cation transport functionality . The protein contains characteristic motifs including:

• Transmembrane helices that form the ion translocation pathway

• Nucleotide-binding domains for ATP binding and hydrolysis

• Actuator, phosphorylation, and nucleotide domains common to P-type ATPases

• Metal-binding sites specific for its target cations

The amino acid sequence (MTLTACEVTAAEAPFDRVSKTIPHPLSWGAALWSVVSVRWATVALLLFLAGLVAQLNGAP...) provided in the product information reveals the complete primary structure that determines the protein's three-dimensional folding and functional capacity .

What expression systems are suitable for recombinant ctpD production?

Recombinant ctpD has been successfully expressed in Escherichia coli (E. coli) expression systems as evidenced by the commercially available protein preparation . When designing expression experiments for membrane proteins like ctpD, researchers should consider:

• Selection of appropriate E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3), or BL21(DE3)pLysS)

• Expression vector selection featuring inducible promoters (T7, tac) for controlled expression

• Optimization of induction conditions (IPTG concentration, temperature, duration)

• Inclusion of fusion tags (N-terminal His-tag has been successfully employed) to facilitate purification and potentially enhance solubility

• Consideration of specialized growth media and additives that support membrane protein folding

For experimental approaches requiring alternative post-translational modifications or eukaryotic expression, yeast systems (Pichia pastoris) might provide advantages over bacterial systems, though this would require protocol adaptation.

What purification strategies and buffer conditions are recommended for recombinant His-tagged ctpD?

Purification of His-tagged ctpD typically follows these methodological steps:

• Cell lysis using appropriate detergents to solubilize the membrane protein (common choices include n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or Triton X-100)

• Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins to capture the His-tagged protein

• Washing steps with increasing imidazole concentrations to reduce non-specific binding

• Elution with high imidazole concentrations (typically 250-500 mM)

• Size exclusion chromatography as a polishing step to achieve >90% purity

Buffer composition typically includes:

• Base buffer: Tris or phosphate buffer (pH 7.5-8.0)

• Salt: 100-300 mM NaCl to maintain protein stability

• Glycerol: 5-10% to prevent aggregation

• Reducing agent: 1-5 mM DTT or 2-mercaptoethanol to maintain reduced cysteines

• Detergent: At concentrations above critical micelle concentration to maintain solubility

The final preparation is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, as indicated in the product information .

What are the optimal storage conditions for maintaining ctpD activity and preventing degradation?

To maintain optimal stability and activity of purified recombinant ctpD protein, researchers should follow these evidence-based storage protocols:

• Store the lyophilized powder at -20°C to -80°C upon receipt

• After reconstitution, store working aliquots at 4°C for short-term use (up to one week)

• For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and store aliquots at -20°C to -80°C

• Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity

• When reconstituting, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

It is advisable to centrifuge the vial briefly before opening to bring the contents to the bottom, especially when working with lyophilized preparations . Researchers should verify protein stability through activity assays or structural integrity tests after extended storage periods.

How can researchers assess the quality and functional integrity of stored ctpD samples?

To verify ctpD quality and functional integrity after storage or before experimental use, researchers should employ multiple complementary approaches:

• SDS-PAGE analysis: To confirm size integrity and purity (>90% purity is the commercial standard)

• Western blot: Using anti-His antibodies to confirm tag presence and protein identity

• ATPase activity assays: Measuring ATP hydrolysis rates using colorimetric phosphate detection methods (malachite green or molybdate assays)

• Thermal shift assays: To assess protein stability and proper folding

• Metal binding assays: Using isothermal titration calorimetry or fluorescence-based methods to confirm metal-binding capacity

• Circular dichroism: To evaluate secondary structure integrity

When analyzing experimental data, researchers should be vigilant about potential contradictions within interdependent data items, as these can serve as indicators of data quality issues, similar to approaches used in clinical study implementation .

What experimental designs are appropriate for studying ctpD function in transport assays?

When investigating the transport function of ctpD, researchers can employ several experimental designs, ranging from in vitro reconstitution to cellular assays:

• Liposome reconstitution assays:

  • Reconstitute purified ctpD into artificial liposomes

  • Create ion gradients across the membrane

  • Monitor ion flux using fluorescent dyes (Fura-2 for calcium) or radioactive isotopes

  • Measure ATPase activity coupled to transport

• Vesicle-based transport assays:

  • Inside-out or right-side-out membrane vesicles from expressing cells

  • Quantify transport using ion-specific indicators or radioisotopes

• Cellular metal sensitivity assays:

  • Express ctpD in metal-sensitive bacterial or yeast strains

  • Challenge with varying concentrations of potential substrate metals

  • Assess growth/survival as a proxy for transport function

• Metal accumulation studies:

  • Express ctpD in appropriate cell lines

  • Measure intracellular metal content by atomic absorption spectroscopy or ICP-MS

How can researchers conduct structure-function analyses of ctpD?

Structure-function analyses of ctpD can be approached through several complementary methodologies:

• Site-directed mutagenesis:

  • Target conserved residues in:

    • ATP binding pocket

    • Phosphorylation site

    • Metal binding sites

    • Transmembrane regions

  • Assess effects on ATPase activity and transport function

• Domain swapping/chimeric constructs:

  • Create chimeras with related P-type ATPases

  • Determine which domains confer specificity for particular metal ions

• Limited proteolysis:

  • Identify stable domains and flexible regions

  • Map functional importance of different structural elements

• Structural studies:

  • X-ray crystallography (challenging for membrane proteins)

  • Cryo-electron microscopy

  • NMR for specific domains

  • Molecular dynamics simulations based on homology models

• Cross-linking studies:

  • Identify interaction partners or conformational changes during catalytic cycle

Each approach provides complementary information about how protein structure relates to cation transport function and ATPase activity.

How can recombination analysis algorithms be applied to study ctpD evolution and diversity?

Analyzing ctpD sequence evolution and diversity requires sophisticated recombination detection approaches:

The JHMM method described by Zilversmit et al. can be applied to ctpD sequences to represent each sequence as a 'mosaic' of segments from other sequences in the dataset, without requiring a full multiple alignment . This is particularly valuable when analyzing diverse ctpD homologs across bacterial species where alignment may be challenging.

The methodology involves:

• Collecting ctpD homolog sequences from multiple bacterial species

• Applying the JHMM method to identify potential recombination events

• Identifying 'recombinant triples' containing a recombinant segment and its two parents

• Using distance-based approaches to identify recombinant sequences in each triple

• Validating recombination events through phylogenetic incongruence tests

What approaches can be used to investigate ctpD interaction with other cellular components?

Investigation of ctpD interactions with other cellular proteins and components requires multiple complementary methodologies:

• Co-immunoprecipitation (Co-IP):

  • Use anti-His antibodies to pull down His-tagged ctpD

  • Identify binding partners by mass spectrometry

  • Validate interactions through reverse Co-IP

• Proximity labeling:

  • Fuse ctpD to BioID or APEX2 enzymes

  • Identify proximal proteins through biotinylation and streptavidin pulldown

  • Mass spectrometry identification of labeled proteins

• Bacterial two-hybrid analysis:

  • Screen for protein-protein interactions in bacterial systems

  • Validate with GST-pulldown or fluorescence resonance energy transfer (FRET)

• Lipidomic analysis:

  • Identify lipid preferences for optimal ctpD function

  • Extract and analyze lipids co-purifying with ctpD

• Functional complementation studies:

  • Express ctpD in cells lacking related transporters

  • Assess rescue of phenotypes related to metal homeostasis

When analyzing complex interaction data, researchers should employ robust experimental designs similar to implementation science approaches that feature manipulation of independent variables and appropriate controls .

What are common challenges in ctpD expression and purification, and how can they be addressed?

Researchers working with recombinant ctpD often encounter several challenges:

These troubleshooting approaches should be systematically documented to maintain data quality and experimental reproducibility .

How can researchers validate the functional activity of purified ctpD?

Functional validation of purified ctpD requires multiple independent approaches:

• ATPase activity assays:

  • Measure ATP hydrolysis rates using:

    • Malachite green phosphate detection

    • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase)

    • Radioactive [γ-32P]ATP hydrolysis

  • Determine kinetic parameters (Km, Vmax) with varying ATP concentrations

  • Assess metal dependence by varying cation concentrations

• Metal binding assays:

  • Isothermal titration calorimetry (ITC) to determine binding affinities

  • Fluorescence-based assays using metal-sensitive fluorophores

  • Equilibrium dialysis with radioactive metal ions

• Transport assays:

  • Proteoliposome-based flux measurements

  • Membrane vesicle transport studies

  • Electrophysiological measurements (if applicable)

• Conformational change detection:

  • Intrinsic tryptophan fluorescence changes upon ATP or metal binding

  • Accessibility of cysteine residues in different conformational states

  • Proteolytic susceptibility differences between E1/E2 states

When analyzing functional data, researchers should be aware of potential contradictions within interdependent data items, which can serve as indicators of data quality issues .

What statistical approaches are recommended for analyzing ctpD activity data?

When analyzing experimental data from ctpD functional studies, researchers should implement robust statistical approaches:

• Enzyme kinetics analysis:

  • Non-linear regression for Michaelis-Menten parameters

  • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visualization

  • Global fitting for inhibition studies

• Transport assays:

  • Time-course analysis using appropriate kinetic models

  • Calculation of initial rates and steady-state parameters

  • Comparison of transport rates across different conditions using ANOVA

• Experimental design considerations:

  • Include appropriate positive and negative controls

  • Perform at least three independent biological replicates

  • Randomize sample processing to minimize batch effects

  • Include technical replicates to assess measurement precision

• Advanced statistical methods:

  • Linear mixed-effects models for experiments with multiple variables

  • Multiple comparison corrections (Bonferroni, Tukey, or false discovery rate)

  • Power analysis to determine appropriate sample sizes

Researchers should consider implementation science approaches that emphasize manipulation of independent variables and appropriate controls when designing experiments and analyzing data .

How can researchers identify and address data contradictions in ctpD research?

Identifying and resolving data contradictions in ctpD research requires systematic approaches:

• Types of contradictions to monitor:

  • Inconsistencies between ATPase activity and transport rates

  • Discrepancies between binding affinity and functional effects

  • Contradictions between structural predictions and functional data

  • Unexpected phenotypes in complementation studies

• Contradiction resolution strategies:

  • Evaluate experimental conditions for differences that might explain results

  • Assess protein quality and purity in divergent experiments

  • Consider post-translational modifications or conformational states

  • Examine different metal ion specificities under varying conditions

• Data quality assessment framework:

  • Establish interdependent data items that should show consistent relationships

  • Use contradiction detection as a pilot indicator of data quality issues

  • Implement structured validation protocols when contradictions are detected

  • Document all contradiction resolution efforts for reproducibility

• Integrative analysis:

  • Combine data from multiple experimental approaches

  • Weight evidence based on methodological rigor

  • Use computational modeling to reconcile seemingly contradictory results

This systematic approach to data contradiction analysis enhances research reliability and facilitates accurate interpretation of complex experimental results.