Recombinant Probable CPS biosynthesis glycosyltransferase

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Probable CPS Biosynthesis Glycosyltransferase refers to a genetically engineered enzyme involved in the assembly of capsular polysaccharide (CPS) repeating units in bacteria. CPS is a critical virulence factor that protects pathogens like Klebsiella pneumoniae and Streptococcus pneumoniae from host immune responses . This glycosyltransferase (GT) catalyzes the transfer of sugar residues from nucleotide-activated donors to lipid-linked acceptors during CPS biosynthesis . Recombinant forms are produced in heterologous systems like Escherichia coli for functional studies and industrial applications .

Key Features:

  • Catalytic Domains:

    • Contains a GT4 family fold for sugar transfer .

    • Predicted N-terminal transmembrane helices for membrane association .

  • Substrate Specificity:

    • Transfers glucose, rhamnose, or glucuronic acid depending on bacterial serotype .

    • Requires lipid carriers like undecaprenyl phosphate (Und-P) for initial glycosylation steps .

Biosynthetic Pathway Integration:

StepRole of Recombinant GTExample Organisms
InitiationBinds Und-P to initiate CPS repeat unitK. pneumoniae , S. pneumoniae
Chain elongationAdds sequential sugars via α/β-linkagesCampylobacter jejuni , S. pneumoniae
TerminationReleases lipid-linked CPS for polymerizationE. coli K1

Production Platforms:

  • Host: E. coli BL21(DE3) with His-tag fusion for purification .

  • Yield: ~66 mg/L polysaccharides in K. pneumoniae YC41-CK; drops to <5 mg/L in mutants lacking GT activity .

Optimization Challenges:

  • Und-P recycling bottlenecks cause cell lysis if CPS synthesis is disrupted .

  • Co-expression with nucleotide sugar biosynthesis genes (e.g., rmlA, rmlB) enhances activity .

Enzymatic Assays:

  • In vitro Activity:

    • Radiolabeled assays using UDP-[¹⁴C]Glc or dTDP-Rha confirm GT specificity .

    • Example: S. pneumoniae Cps2G adds α1-2 Glc to lipid-linked Rha₃-Glc intermediates .

Kinetic Parameters:

ParameterValueSource
KmK_m (UDP-Glc)0.8 mM
VmaxV_{max}12 nmol/min/mg

Vaccine Development:

  • Serotype-specific CPS is a target for conjugate vaccines (e.g., pneumococcal 23-valent vaccine) .

  • Recombinant GT enables structure-guided engineering of immunogenic CPS variants .

Biotechnological Uses:

  • Synthesis of sulfated CPS for anticoagulant drug candidates .

  • Microbial production of bioengineered heparosan analogs .

Challenges and Future Directions

  1. Functional Redundancy: Multiple GTs often share overlapping activities (e.g., C. jejuni NCTC 11168 has seven putative GTs) .

  2. Structural Flexibility: Cryo-EM reveals conformational changes in KpsMT–KpsE complexes during glycolipid translocation .

  3. Host Toxicity: Engineering GT variants with reduced Und-P dependency is critical for scalable CPS production .

Key Research Findings

  1. Klebsiella pneumoniae:

    • Recombinant GT (UniProt ID: N/A) from strain YC41 has a 465-aa sequence with GT4 domain .

    • Deletion reduces CPS yield by 95% (<5 mg/L vs. 66 mg/L in wild type) .

  2. Streptococcus pneumoniae:

    • WciS (Cap8H) transfers α-galactose in serotype 8 CPS .

    • Cps2F-Cps2G tandem activity synthesizes branched Rha-Glc backbones .

  3. Gram-Negative Systems:

    • KpsC/KpsS in E. coli assemble poly-Kdo glycolipid anchors for CPS export .

Comparative Analysis of GT Families

GT FamilyOrganismFunctionReference
GT4K. pneumoniaeα-Glucosyltransferase
GT2E. coli K1β-Kdo transferase
GT1C. jejuniHeptosyltransferase

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase; UDP-Glc:Und-P Glc-1-P transferase; Capsular polysaccharide biosynthesis lipid carrier glucose-1-P transferase; Glucosyl-P-P-undecaprenol synthase; ORF14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Protein Sequence
MTISQHRFRSNANASIISMLQRFSDILIIFLGIYFSCFINDYFFNLHYVLMALVALVVFQ MIGGITDFYRSWRGVEFSVELILILKNWSLSFLLTLGFVTLFSDFDLTFRTFIFWYLAVC AGFVVTRPLIRALAGFFRRIGYNKRRVAFAGSLPAGISLLETFRKQPWLGFEVKGIYEDS FSGTYDLELYAGKISDLINEARKGTIDRIYIAMHMRDEVAIKNMVSQLTDTTCSVLYIPD VFTFNILQSRTEEINGVPVVPLFDSPLNGINMVFKRLEDIIVSSLILILISPILLVIATA VKTTSKGPVIFRQVRYGMDGKPIKVWKFRSMTVMENDDKVIQATKNDIRVTKVGKFLRST SLDELPQFFNVLFGQMSVVGPRPHAVSHNEQYRSLIQGYMLRHKVKPGITGLAQINGWRG ETDTLEKMEKRIEYDLLYIRGWSIWLDLKIIFLTVFKGFINKSAY
Uniprot No.

Target Background

Function

This protein is likely the initiating enzyme for K2 capsular polysaccharide synthesis. It catalyzes the transfer of the glucose-1-phosphate moiety from UDP-Glc to the lipid carrier undecaprenyl phosphate (C55-P), forming a phosphoanhydride bond to yield glucosyl-pyrophosphoryl-undecaprenol (Glc-PP-C55).

Protein Families
Bacterial sugar transferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are CPS biosynthesis glycosyltransferases and how do they function in bacterial systems?

CPS biosynthesis glycosyltransferases are enzymes responsible for the assembly of capsular polysaccharides that fortify the cell boundaries of many commensal and pathogenic bacteria. These enzymes catalyze the transfer of specific carbohydrate residues from nucleotide- or lipid-pyrophosphate-activated donors to growing carbohydrate chains, proteins, or lipid acceptor substrates . In the ABC-transporter-dependent biosynthesis pathway, CPSs are synthesized intracellularly on a lipid anchor and subsequently secreted across the cell envelope by dedicated transport machinery such as the KpsMT ABC transporter in Gram-negative bacteria . The glycosyltransferases involved in CPS biosynthesis often show remarkable substrate specificity, though transporters like KpsMT demonstrate broader substrate recognition .

How are CPS glycosyltransferases classified and what structural features differentiate them?

CPS glycosyltransferases are primarily classified into families based on protein sequence similarities as documented in the Carbohydrate-Active enZYmes database (CAZy). The majority of mechanistic research distinguishes between "inverting" and "retaining" mechanisms, which refers to the anomeric configuration of the new glycosidic bond relative to the linkage in the donor substrate . For example:

  • Inverting glycosyltransferases: The anomeric configuration in the product is opposite to that in the donor (e.g., UDP-α-GlcNAc forming β-GlcNAc linkages via TarS).

  • Retaining glycosyltransferases: The anomeric configuration remains the same between donor and product (e.g., forming α-GlcNAc linkages via TarM) .

Additionally, CPS glycosyltransferases can be differentiated based on the direction of chain elongation (reducing end vs. non-reducing end) and on their processivity characteristics .

What expression systems yield optimal activity for recombinant CPS glycosyltransferases?

For successful expression of recombinant CPS glycosyltransferases, mammalian cell expression systems using COS-1 or COS-7 cells have proven effective, particularly when using vectors like pEF-BOS/IP . The search results indicate that truncated forms of glycosyltransferases, lacking the cytoplasmic and transmembrane domains, can be successfully expressed using transfection reagents such as FuGENE 6 or Lipofectamine 3000 .

The expression strategy should account for the membrane-associated nature of many glycosyltransferases. For optimal activity:

  • Remove N-terminal transmembrane domains while preserving the catalytic domain

  • Consider adding affinity tags for purification (His-tag or GST)

  • Maintain proper protein folding with appropriate temperature conditions (typically 25-30°C)

  • Supplement growth media with required metal cofactors (Mn²⁺ or Mg²⁺) if necessary for activity

What are the critical factors for maintaining enzymatic activity during purification of recombinant glycosyltransferases?

Maintaining the activity of recombinant CPS glycosyltransferases during purification requires careful consideration of several factors:

FactorRecommendationRationale
Buffer pH7.0-8.0Most glycosyltransferases show optimal activity in this range
Detergent selectionMild non-ionic (DDM, CHAPS)Preserves native conformation while solubilizing
Metal ionsMn²⁺ or Mg²⁺ (1-5 mM)Many glycosyltransferases require divalent cations for activity
Temperature4°C during purificationMinimizes proteolytic degradation
Glycerol content10-20%Stabilizes protein structure
Reducing agentsDTT or β-mercaptoethanol (1-5 mM)Prevents oxidation of critical cysteine residues

Additionally, when expressing glycosyltransferases that naturally form multimeric complexes, it's important to maintain conditions that preserve these higher-order structures. Some glycosyltransferases show enhanced processivity when in trimeric form, as observed with TarS, which exhibited a significantly higher intrinsic processivity (Pintr of 2400 ± 260) compared to a truncated version lacking the trimerization domain (Pintr of 133 ± 14) .

What established methods exist for assaying recombinant CPS glycosyltransferase activity?

Several established methods can be employed to assess the activity of recombinant CPS glycosyltransferases:

  • Radiometric assays: Using radiolabeled UDP-[U-¹⁴C]GlcA as donor substrate and measuring incorporation into acceptors. This is particularly useful for measuring GlcAT-I and CS-GlcAT-II activities .

  • Coupled enzyme assays: Monitoring the release of UDP or other nucleotide diphosphates using coupling enzymes that convert these products to detectable signals.

  • HPLC-based methods: Analyzing the formation of oligosaccharide products directly by separating them based on size or charge.

  • Mass spectrometry: Providing detailed structural information about the products formed, especially useful for identifying novel glycosidic linkages.

  • Processivity measurements: Specialized kinetic analyses to determine whether the enzyme operates processively or distributively. This involves comparing initial and steady-state rates, or analyzing product distribution patterns .

How can the processivity of CPS glycosyltransferases be experimentally determined?

Determining the processivity of CPS glycosyltransferases requires specialized experimental approaches:

  • Kinetic analysis with lag phase observation: A lag phase in product formation that disappears when using longer oligosaccharide acceptors suggests processivity. For example, PG transferase showed processive behavior when a lag-phase disappeared as the concentration of the first catalytic product increased or when synthetic Lipid IV (a Lipid II dimer) was directly used as the donor .

  • Intrinsic processivity calculation: The intrinsic processivity (Pintr) can be calculated through specialized kinetic experiments. For example, TarS and TarM showed different Pintr values (2400 ± 260 vs. 73 ± 10, respectively) illustrating different degrees of processivity .

  • Product distribution analysis: Analyzing the pattern of products formed, where processive enzymes typically produce longer chains with fewer intermediate-length products.

  • Single-molecule imaging techniques: Advanced methods like optical tweezers or fluorescence resonance energy transfer (FRET) can directly observe substrate association/dissociation events .

What critical controls should be included when working with novel or uncharacterized glycosyltransferases?

When working with novel or uncharacterized CPS biosynthesis glycosyltransferases, several critical controls should be included:

  • Negative enzyme control: Reactions without enzyme or with heat-inactivated enzyme

  • Donor/acceptor specificity controls: Testing related nucleotide-sugar donors and structural analogs of acceptors

  • Metal ion dependency: Testing activity with and without divalent cations (Mn²⁺, Mg²⁺)

  • pH and buffer optimization: Determining optimal reaction conditions

  • Enzyme concentration linearity: Confirming that activity scales linearly with enzyme concentration

  • Site-directed mutagenesis controls: Mutating predicted catalytic residues to confirm mechanism

  • Product characterization: Using multiple methods (MS, NMR) to confirm the structure of enzymatic products

What structural elements contribute to the catalytic mechanism and substrate recognition in CPS glycosyltransferases?

Several key structural elements contribute to catalysis and substrate recognition in CPS glycosyltransferases:

  • Flexible binding loops: Many glycosyltransferases contain flexible polypeptide patches that close upon substrate binding, enhancing binding affinity and catalytic efficiency .

  • Large acceptor substrate-binding grooves: These facilitate the sliding of growing polysaccharide chains along the template, promoting processivity in enzymes like chitin hydrolases .

  • Positively charged grooves: In certain glycosyltransferases like TarS, positively charged grooves in the acceptor-binding domain bind negatively charged acceptor substrates and facilitate their sliding during processive glycosyl transfer .

  • Oligomerization: Trimerization can significantly enhance processivity, as demonstrated with TarS where the wild-type enzyme showed a Pintr of 2400 ± 260, compared to 133 ± 14 for a truncated version lacking the trimerization domain .

  • Membrane canyon structures: In CPS secretion systems like KpsMT, a membrane-exposed electropositive canyon recognizes glycolipids, with in vivo assays confirming the functional importance of canyon-lining basic residues .

How do oligomerization states affect the function and processivity of CPS glycosyltransferases?

Oligomerization plays a critical role in the function and processivity of many CPS glycosyltransferases:

The significance of oligomerization appears to vary between enzymes. For instance, while trimerization dramatically enhances processivity in TarS (an inverting enzyme), the retaining enzyme TarM showed a much lower intrinsic processivity (Pintr of 73 ± 10) that was less dependent on its oligomeric state .

How can recombinant CPS glycosyltransferases be utilized to study bacterial virulence mechanisms?

Recombinant CPS glycosyltransferases offer powerful tools for studying bacterial virulence mechanisms:

  • Structure-function analysis: By expressing recombinant glycosyltransferases with specific mutations, researchers can correlate structural features with capsule synthesis capabilities and virulence.

  • Capsule modification: Engineered glycosyltransferases can be used to produce modified capsular structures, allowing assessment of how specific structural features contribute to immune evasion or host-pathogen interactions.

  • Inhibitor development: Recombinant enzymes facilitate high-throughput screening for inhibitors that could serve as novel antimicrobials targeting capsule biosynthesis.

  • Vaccine development: Understanding the precise mechanisms of capsule biosynthesis can inform the design of glycoconjugate vaccines or attenuated strains with modified capsular structures.

  • Cross-species comparison: Comparative studies of glycosyltransferases from different pathogens can reveal conserved mechanisms and species-specific adaptations in capsule biosynthesis .

What approaches help determine the in vivo function of specific CPS glycosyltransferases in bacterial pathogenesis?

Several complementary approaches help determine the in vivo functions of specific CPS glycosyltransferases:

  • Gene knockout studies: Targeted deletion of glycosyltransferase genes can reveal their roles in capsule biosynthesis and virulence. For example, prior gene knockout experiments established that Cj1431 in C. jejuni NCTC 11168 is required for the transfer of d-glycero-l-gluco-heptose to the growing polymeric chain .

  • Complementation assays: Reintroducing wild-type or mutant glycosyltransferase genes into knockout strains can confirm gene function and identify critical residues.

  • Super-resolution microscopy: Advanced imaging techniques can visualize the cellular localization and organization of CPSs on bacterial surfaces, as demonstrated in recent studies of CPS secretion in Gram-negative bacteria .

  • In vivo infection models: Comparing the virulence of wild-type strains with those expressing modified glycosyltransferases can reveal the contribution of specific capsular structures to pathogenesis.

  • Comparative genomics: Analysis of glycosyltransferase gene clusters across strains with different virulence properties can identify correlations between specific enzymes and pathogenicity. Sequencing of biosynthetic CPS regions (15-34 kb) from various C. jejuni strains has provided evidence for multiple mechanisms of structural variation, including horizontal gene transfer, gene duplication, deletion, fusion, and contingency gene variation .

What are the current technical challenges in studying CPS glycosyltransferase mechanisms?

Current technical challenges in studying CPS glycosyltransferase mechanisms include:

  • Membrane-associated nature: Many glycosyltransferases are membrane-associated, making them difficult to express, purify, and crystallize for structural studies.

  • Complex kinetics: Processive enzymes often display complex kinetic behaviors that are challenging to analyze using conventional enzyme kinetic approaches .

  • Substrate availability: Obtaining or synthesizing the complex oligosaccharide acceptors needed for in vitro studies can be technically demanding.

  • Enzymatic complexes: Many glycosyltransferases function in multi-enzyme complexes, making it difficult to study individual components in isolation.

  • Structural determination: Obtaining high-resolution structures of glycosyltransferases with bound substrates remains challenging, particularly for membrane-associated enzymes.

How might structural biology approaches contribute to understanding CPS glycosyltransferase function?

Advanced structural biology approaches offer promising avenues for understanding CPS glycosyltransferase function:

  • Cryo-electron microscopy: Recent cryo-EM analyses of complexes like KpsMT–KpsE have revealed molecular details of CPS secretion, including conformational rearrangements during ATP hydrolysis and substrate recognition mechanisms .

  • AlphaFold2 and other AI prediction tools: These can predict protein structures with increasing accuracy, as demonstrated for the C. jejuni NCTC 11168 Cj1432 protein, where AlphaFold2 predicted the structure, revealing distinct functional domains .

  • Molecular dynamics simulations: These can provide insights into the dynamic aspects of enzyme-substrate interactions and conformational changes during catalysis.

  • X-ray crystallography with substrate analogs: Using substrate analogs or inactive enzyme mutants can help capture enzyme-substrate complexes for structural analysis.

  • NMR studies: Solution NMR can provide dynamic information about flexible regions involved in substrate binding and catalysis.

  • Single-particle analysis: This approach can reveal the heterogeneity and dynamics of glycosyltransferase complexes in different functional states.

What emerging methodologies might overcome current limitations in glycosyltransferase research?

Several emerging methodologies show promise for overcoming current limitations:

  • Nanodiscs and lipid cubic phase crystallization: These approaches may facilitate structural studies of membrane-associated glycosyltransferases.

  • Single-molecule enzymology: Techniques like single-molecule FRET can directly observe the processivity and dynamics of individual enzyme molecules.

  • Cell-free expression systems: These may enable the production of difficult-to-express glycosyltransferases with proper folding and activity.

  • Synthetic biology approaches: Designing minimal glycosyltransferase systems can simplify the study of complex multi-enzyme processes.

  • CRISPR-based genome editing: This allows precise manipulation of glycosyltransferase genes in their native genomic context.

  • Integrated multi-omics approaches: Combining transcriptomics, proteomics, and glycomics can provide a systems-level understanding of glycosyltransferase function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.