Recombinant Probable cytochrome b561 (cybB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Probable Cytochrome b561 (cybB) encompasses engineered variants of CYB561D1 and CYB561D2 isoforms, studied extensively in mice (Mm_CYB561D1/D2) and humans (Hs_CYB561D1/D2). These proteins belong to the cytochrome b561 family, which facilitates trans-membrane electron transfer (TMET) using ASC as an electron donor . Their recombinant forms enable detailed spectroscopic, redox, and structural analyses that are challenging with native proteins due to low natural abundance .

Core Architecture

  • Transmembrane Domains: Six α-helical transmembrane segments, with four central helices forming a conserved "CYB561-core" coordinating two heme-b molecules via histidine residues .

  • Heme Coordination: Each heme is ligated by two histidine residues:

    • HP-heme (high-potential): Cytosolic side, midpoint potential ~+160 mV.

    • LP-heme (low-potential): Intravesicular/luminal side, midpoint potential ~+60 mV .

  • Homology Modeling: Predicted structural similarity to other CYB561 members, with asymmetric electrostatic environments around heme pockets influencing redox splitting .

Spectroscopic Features

PropertyMm_CYB561D1 Findings Comparison to Other CYB561s
Heme Content2 hemes per protein (2:1 ratio)Consistent with CYB561D2 and plant forms
Optical AbsorptionOxidized: λ_max = 418 nm (ε = 155,200 M⁻¹cm⁻¹)
Reduced: λ_max = 432 nm (ε = 238,000 M⁻¹cm⁻¹)
Similar to Hs_CYB561D2 and At_CYB561B1
EPR SignaturesHighly asymmetric low-spin (HALS) hemes; no rhombic distortionDistinct from CYB561A subfamily
Midpoint PotentialsHP-heme: +160 mV
LP-heme: +60 mV
Broader redox splitting than 4D2 scaffold

Redox Activity

  • ASC Reduction: Biphasic kinetics with high- and low-affinity ASC-binding sites (K_d ≈ 0.01 mM and 1 mM) .

  • Electron Transfer: Sequential HP → LP heme reduction enables TMET, critical for ASC regeneration and Fe³⁺ reduction .

Physiological Functions

  • ASC Recycling: Regenerates ASC from MDA, supporting antioxidant defense and iron uptake .

  • Iron Metabolism: Reduces extracellular Fe³⁺ to Fe²⁺, enabling transport via divalent metal transporters (e.g., DMT1) .

Cancer Pathology

  • Tumor Suppression: Hs_CYB561D2 (101F6) and Mm_CYB561D1 show altered expression in lung cancer and glioma, influencing tumor growth .

  • Therapeutic Potential: Differential expression in tumors (e.g., upregulated in breast cancer) correlates with prognosis, suggesting utility as biomarkers or targets .

Key Findings

  • Heterologous Expression: Successfully produced in Saccharomyces cerevisiae and E. coli, enabling purification and functional assays .

  • Electron Transfer Mechanism: HP-heme acts as the ASC oxidation site, while LP-heme reduces MDA or Fe³⁺ .

  • Mutational Insights: His/Lys mutations disrupt heme coordination and redox activity, validating structural predictions .

Unresolved Questions

  • Substrate Specificity: Why do some CYB561 isoforms (e.g., Dcytb) lack Fe³⁺-reductase activity in tumors despite conserved domains?

  • Pathological Mechanisms: How do CYB561D1/D2 regulate tumor growth? Proposed pathways include ROS modulation and iron homeostasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag type, please inform us during your order, and we will prioritize its implementation.
Synonyms
cybB; cybB1; YPO3321; y0868; YP_0365; Probable cytochrome b561; Cytochrome b-561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Yersinia pestis
Target Names
Target Protein Sequence
MHKKYSCLQIGIHWLVLLLVIIAWSSIELRGFAPRSYQPWMKMIHFSCGIAILVLMMTRI LIQLRYPTPPIVPKPSPMIVGLAHVGHWVIYLLFIALPIIGIAILYCRGSSWIAFGLIMP HAEQANFDLADTLKAYHLLLANMSYFVIGLHALAALLHHYVLKDNTLLRMMPKKRG
Uniprot No.

Target Background

Database Links

KEGG: ype:YPO3321

STRING: 187410.y0868

Protein Families
Cytochrome b561 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of cytochrome b561?

Cytochrome b561 is a highly hydrophobic transmembrane protein consisting of six transmembrane domains with two heme-b redox centers, one on each side of the host membrane. The structure reveals that the protein spans the membrane six times with little extramembranous sequence . High-resolution crystal structures show that each protomer contains six transmembrane segments (TMs) with both the N and C termini located in the cytoplasm . The two heme groups are partially exposed to solvent, with positively charged cavities on each side of the membrane that serve as substrate-binding sites . The four conserved histidine residues in the central four transmembrane helices coordinate the two heme-b chromophores .

What are the primary functional characteristics of cytochrome b561?

The defining functional characteristics of cytochrome b561 include:

  • Ascorbate reducibility: The protein can be reduced by ascorbate, a property fundamental to its biological function .

  • Transmembrane electron transfer: Cytochrome b561 can transport electrons across membranes, linking redox reactions on opposite sides .

  • Participation in ascorbate recycling and iron homeostasis: This protein plays crucial roles in vitamin C metabolism and iron regulation .

  • Supply of reducing equivalents: It provides electrons to intravesicular enzymes like dopamine-beta-hydroxylase and alpha-peptide amidase .

The distinctive ascorbate/monodehydroascorbate or ascorbate/ferric-chelate electron donor/acceptor pairs differentiate cytochrome b561 from other heme-containing proteins such as cytochrome b6 .

What expression systems are commonly used for recombinant cytochrome b561 production?

Recombinant cytochrome b561 has been successfully expressed in yeast systems, particularly Saccharomyces cerevisiae cells, which allow for proper membrane protein integration and post-translational modifications . This expression system has been used for the mouse ortholog (Mm_CYB561D1), enabling subsequent purification from yeast membranes and detailed characterization of its properties . When designing expression systems for cytochrome b561, researchers must consider the need for proper membrane integration, heme incorporation, and maintaining the protein's native conformation to preserve its functional characteristics.

What spectroscopic methods are most effective for characterizing cytochrome b561 redox properties?

Multiple complementary spectroscopic approaches are essential for comprehensive characterization of cytochrome b561's redox properties:

  • Circular Dichroism (CD) Spectroscopy: This method can assess potential electronic interactions between the two heme-b centers. For example, studies on Mm_CYB561D1 revealed no electronic interaction between the heme centers .

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: EPR is crucial for determining the spin state and coordination environment of heme centers. In Mm_CYB561D1, EPR analysis demonstrated that both hemes exhibit a highly asymmetric low-spin (HALS) character . The absence of significant EPR peaks around gz = 3.16 (typically assigned to rhombic heme environments in other cytochrome b561 proteins) provides important comparative data about heme coordination .

  • Redox Titration Experiments: These experiments determine the midpoint reduction potentials of the heme centers, which are critical parameters for understanding electron transfer capabilities. For Mm_CYB561D1, these potentials were found to be comparable to other members of the CYB561 protein family .

When interpreting spectroscopic data, researchers should adopt complex models that account for the potential interactions between the two heme centers and their distinct environments within the transmembrane domain.

How can researchers effectively determine binding constants for substrate interactions with cytochrome b561?

Determining binding constants for substrates such as ascorbate requires a methodical approach:

  • Spectrophotometric Titrations: By monitoring changes in the absorbance spectra of the heme groups upon incremental addition of ascorbate, researchers can generate binding curves.

  • Isothermal Titration Calorimetry (ITC): This technique provides direct measurement of heat changes during binding events, offering both binding constants and thermodynamic parameters.

  • Surface Plasmon Resonance (SPR): For studying interaction kinetics between cytochrome b561 and potential binding partners or substrates.

For Mm_CYB561D1, binding constants for the two putative ascorbate binding sites were determined to be comparable to other members of the CYB561 protein family . When designing such experiments, researchers should consider that cytochrome b561 contains two substrate binding sites with potentially different affinities, necessitating models that account for multiple binding events.

What structural analysis techniques reveal the most about cytochrome b561 transmembrane electron transfer pathways?

Several complementary structural approaches provide insights into electron transfer pathways:

  • X-ray Crystallography: High-resolution crystal structures (e.g., 1.7 Å resolution) reveal the arrangement of transmembrane helices, heme positions, and substrate binding sites . The structure of cytochrome b561 from Arabidopsis thaliana shows that each protomer contains six transmembrane segments with two heme groups partially exposed to solvent .

  • Homology Modeling: For variants lacking experimental structures, homology modeling based on resolved structures can predict transmembrane arrangements and potential electron pathways .

  • Site-Directed Mutagenesis combined with Functional Assays: Systematic mutation of residues along potential electron transfer paths, followed by activity measurements, can map critical residues.

  • Molecular Dynamics Simulations: These can model electron transfer kinetics through predicted pathways in the protein.

Structural analysis of cytochrome b561 from Arabidopsis thaliana identified two highly conserved amino acids, Lys81 and His106, that play essential roles in substrate recognition and catalysis . These findings establish a framework for understanding the general electron transfer mechanism across the cytochrome b561 family.

How should researchers interpret spectral differences between the two heme centers in cytochrome b561?

Interpreting spectral differences between heme centers requires careful consideration of several factors:

  • Spectral Symmetry Analysis: Some cytochrome b561 proteins show distinct spectral signatures for each heme, while others, like Mm_CYB561D1, show no discernible spectral differences . The absence of spectral differences doesn't necessarily indicate identical environments but may reflect compensating effects that result in similar spectroscopic properties.

  • EPR Signal Attribution: EPR signals can reveal the coordination environment of each heme. For instance, the absence of signals around gz = 3.16 in Mm_CYB561D1, typically assigned to rhombic heme environments in other cytochrome b561 proteins, suggests unique coordination environments .

  • Comparative Analysis: Researchers should compare their findings with other characterized cytochrome b561 proteins to identify conserved and variant spectral features.

When both hemes show highly asymmetric low-spin (HALS) character, as in Mm_CYB561D1, researchers should consider that this may reflect the protein's specific electron transfer mechanism and substrate interaction mode .

What factors contribute to discrepancies in redox potential measurements across different cytochrome b561 studies?

Several experimental and biological factors can lead to variations in reported redox potentials:

FactorImpact on MeasurementsMitigation Strategy
Purification methodsDifferent detergents or buffer compositions can alter protein conformationStandardize purification protocols; report detailed methods
Measurement techniquesDifferent electrochemical methods have varying sensitivitiesUse multiple complementary techniques; calibrate against standards
pH and ionic strengthThese affect protonation states and electrostatic interactionsPerform measurements across pH/ionic strength ranges
Recombinant vs. native proteinExpression systems may influence post-translational modificationsCompare with native protein when possible
Temperature variationsAffect thermodynamics of redox reactionsControl temperature precisely; report temperature conditions

Researchers should analyze redox titration experiments using complex models that account for potential interactions between the two heme centers. For example, in studies of Mm_CYB561D1, redox titration data were analyzed within a framework that considered the distinct environments of each heme center .

How can researchers distinguish between direct and indirect effects when studying cytochrome b561 in complex biological systems?

Distinguishing direct from indirect effects in complex systems requires multiple experimental approaches:

  • Reconstitution Experiments: Incorporating purified cytochrome b561 into defined membrane systems with controlled components to establish direct interactions.

  • Proximity Labeling Techniques: Using methods like BioID or APEX2 to identify proteins in close proximity to cytochrome b561 in cellular environments.

  • Time-Resolved Measurements: Monitoring the kinetics of responses can help differentiate primary (direct) from secondary (indirect) effects.

  • Correlation vs. Causation Analysis: In studies examining cytochrome b561's role in cancer, researchers should distinguish between correlative relationships (e.g., expression changes) and causal mechanisms through functional studies.

For example, in breast cancer studies, CYB561 expression was found to be upregulated and correlated with poor survival outcomes, but determining whether this is a direct mechanistic driver or an indirect consequence of other cancer-related processes requires additional mechanistic investigation .

What evidence supports the role of cytochrome b561 as a biomarker in cancer?

Multiple lines of evidence support CYB561's potential as a cancer biomarker:

The correlations between CYB561 expression and specific cancer subtypes (particularly infiltrating ductal carcinoma, where 78.97% of cases showed high CYB561 expression compared to 68.91% in the low expression group) suggest potential subtype-specific roles .

What molecular mechanisms explain cytochrome b561's potential role in cancer progression?

Several molecular mechanisms potentially link cytochrome b561 to cancer progression:

  • Pathway Enrichment: Functional enrichment analysis has shown that CYB561 and its co-expressed genes are primarily enriched in:

    • Lipid biosynthetic processes

    • Wnt signaling pathway

    • Hippo signaling pathway

    These pathways are well-established contributors to cancer development and progression.

  • miRNA Regulatory Networks: miRNA network analysis identified hsa-miR-497 as negatively correlated with CYB561 expression and predicted to directly target CYB561 . This suggests a regulatory mechanism that may be dysregulated in cancer.

  • Immune Cell Infiltration: CYB561 expression positively correlates with infiltrating levels of:

    • CD4+ T cells

    • Neutrophils

    • Dendritic cells

    This implicates potential roles in modulating the tumor immune microenvironment.

  • Iron Homeostasis: Given cytochrome b561's established role in iron metabolism, its dysregulation may affect intracellular iron levels, which are critical for cancer cell proliferation and survival.

Researchers investigating these mechanisms should design experiments that specifically target each pathway while monitoring CYB561 expression and function to establish causal relationships rather than mere correlations.

How do variants of cytochrome b561 differ in their structure-function relationships and physiological roles?

The cytochrome b561 family encompasses several variants with distinct structure-function relationships:

  • Classification: CYB561s have been classified into seven groups based on primary structural similarities, with five groups containing the core six transmembrane domains .

  • Mammalian Homologs: In humans and rodents, multiple homologs exist:

    • Tumor suppressor 101F6 protein (Hs_CYB561D2) and its mouse ortholog (Mm_CYB561D2)

    • Hs_CYB561D1 in humans and Mm_CYB561D1 in mice

  • Functional Specialization: Despite structural similarities, different variants appear in distinct cellular contexts:

    • Original CYB561: Found in secretory vesicles containing catecholamines and amidated peptides, supplying reducing equivalents to intravesicular enzymes

    • CYB561D1/D2: May participate in cancer pathology through yet unidentified mechanisms

  • Structural Variations: While the core transmembrane organization is conserved, variants show differences in:

    • Spectral properties of heme centers (some show distinct spectral signatures for each heme, while others like Mm_CYB561D1 do not)

    • EPR signals (presence or absence of signals around gz = 3.16)

    • Substrate binding affinities

When studying different variants, researchers should consider these structural and functional differences when designing experiments and interpreting results. Comparative studies across variants may provide insights into structure-function relationships within this protein family.

What controls are essential when characterizing recombinant cytochrome b561 proteins?

Rigorous controls are critical for reliable characterization of recombinant cytochrome b561:

  • Protein Integrity Controls:

    • Size-exclusion chromatography to verify proper folding and oligomeric state

    • Western blotting with antibodies targeting different epitopes to confirm full-length expression

    • Mass spectrometry to verify protein sequence and post-translational modifications

  • Functional Controls:

    • Ascorbate oxidation assays with varying substrate concentrations

    • Comparison with known cytochrome b561 variants with established activities

    • Negative controls using denatured protein or proteins with mutated heme-binding sites

  • Spectroscopic Controls:

    • Baseline measurements before and after protein addition

    • Comparison of oxidized and reduced spectra to established reference spectra

    • Treatment with ferricyanide during protein purification to ensure oxidation of heme groups, which has been shown to improve protein homogeneity and crystal diffraction quality

  • Expression System Controls:

    • Empty vector controls to account for background host cell proteins

    • Comparison of different expression systems (e.g., bacterial, yeast, insect, mammalian) to identify system-specific artifacts

Proper controls are particularly important when characterizing variants with subtle differences, such as the homologs Hs_CYB561D1 in humans and Mm_CYB561D1 in mice .

What are the optimal conditions for measuring electron transfer rates in cytochrome b561?

Optimal conditions for electron transfer measurements must balance physiological relevance with experimental reproducibility:

ParameterOptimal RangeRationale
pH6.8-7.4Physiological range; affects protonation states of key residues
Temperature25-37°CLower temperatures provide stability, higher temperatures reflect physiological conditions
Buffer compositionLow ionic strength (50-150 mM)Minimizes screening of electrostatic interactions
Lipid environmentPhospholipid composition mimicking native membraneMaintains native protein conformation and orientation
Ascorbate concentration0.1-10 mMCovers physiological range and saturating conditions
Electron acceptorsFerric-chelates or monodehydroascorbateNatural electron acceptors for cytochrome b561

Researchers should monitor the redox states of both heme centers simultaneously when possible, as the electron transfer between them may be rate-limiting. Time-resolved spectroscopic techniques are particularly valuable for capturing the kinetics of electron flow through the protein. When studying the mechanism of electron transfer, consideration of the conserved amino acids Lys81 and His106 is essential, as they play critical roles in substrate recognition and catalysis .

How should researchers approach mutation studies to investigate the functional roles of conserved residues in cytochrome b561?

A systematic approach to mutation studies is essential for understanding structure-function relationships:

  • Residue Selection Strategy:

    • Target the four conserved histidines that coordinate the heme groups

    • Focus on residues identified in crystal structures as involved in substrate binding (e.g., Lys81 and His106)

    • Investigate residues in potential electron transfer pathways between the two hemes

    • Examine residues at the protein-membrane interface that may influence orientation

  • Mutation Design Principles:

    • Conservative substitutions to maintain structural integrity (e.g., His→Asn)

    • Charge reversal mutations to test electrostatic interactions (e.g., Lys→Glu)

    • Alanine scanning to assess the contribution of side chains

    • Introduction of spectroscopic probes at strategic positions

  • Functional Readouts:

    • Electron transfer rates under various conditions

    • Substrate binding affinities

    • Protein stability and membrane integration

    • Spectroscopic properties of heme environments

  • Analytical Approach:

    • Compare effects across multiple mutations to identify patterns

    • Correlate functional changes with structural alterations

    • Validate findings across different cytochrome b561 variants

When interpreting mutation studies, researchers should consider that some residues may have multiple roles (structural, functional, regulatory), and mutations may have complex effects beyond the targeted function.

What are the most promising approaches for targeting cytochrome b561 in cancer therapeutics?

Several strategic approaches show promise for targeting cytochrome b561 in cancer:

  • Direct Inhibition Strategies:

    • Small molecule inhibitors designed to bind the ascorbate binding sites

    • Peptide-based inhibitors targeting the heme coordination sites

    • Allosteric modulators affecting electron transfer efficiency

  • Gene Expression Modulation:

    • siRNA or antisense oligonucleotides to reduce CYB561 expression

    • CRISPR-based approaches to knock out or modify CYB561

    • Epigenetic modulators affecting CYB561 promoter activity

  • miRNA-Based Approaches:

    • Delivery of hsa-miR-497, which is negatively correlated with CYB561 expression and predicted to directly target it

    • Development of miRNA mimics to enhance endogenous regulation

  • Combination Strategies:

    • Targeting CYB561 alongside Wnt or Hippo pathway inhibitors, as these pathways are enriched in CYB561 co-expression networks

    • Combining with immune checkpoint inhibitors, given CYB561's correlation with immune cell infiltration

Researchers should prioritize approaches that exploit cancer-specific dependencies on CYB561 to minimize effects on normal tissues, particularly considering CYB561's role in essential processes like ascorbate recycling and iron homeostasis.

What technological advances would most benefit cytochrome b561 research?

Several technological advances would significantly accelerate cytochrome b561 research:

  • Structural Biology Innovations:

    • Cryo-EM techniques optimized for membrane proteins to capture dynamic states during electron transfer

    • Time-resolved crystallography to visualize conformational changes during catalysis

    • Advanced neutron diffraction methods to precisely locate hydrogen atoms in proton transfer pathways

  • Spectroscopic Advances:

    • Single-molecule spectroscopy to observe electron transfer events in individual protein molecules

    • Advanced EPR techniques with improved sensitivity for detecting subtle changes in heme environments

    • In-cell spectroscopy to monitor cytochrome b561 activity in living cells

  • Computational Approaches:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of electron transfer

    • Machine learning algorithms to predict functional impacts of mutations

    • Systems biology models integrating cytochrome b561 into cellular redox networks

  • Cell Biology Tools:

    • Genetically encoded biosensors for monitoring cytochrome b561 activity in real-time

    • High-throughput screening platforms for identifying modulators of cytochrome b561 function

    • Organoid models to study cytochrome b561 in complex tissue contexts

These technological advances would help resolve outstanding questions about the electron transfer mechanisms, physiological roles, and potential therapeutic targeting of cytochrome b561 variants.

How might better understanding of cytochrome b561 impact our knowledge of ascorbate metabolism and related pathologies?

Enhanced understanding of cytochrome b561 has far-reaching implications:

  • Ascorbate Recycling Mechanisms:

    • Clarification of the complete cycle of ascorbate oxidation and reduction in various cellular compartments

    • Identification of rate-limiting steps in ascorbate recycling that may be targeted to enhance vitamin C efficacy

    • Understanding tissue-specific variations in ascorbate metabolism

  • Iron Metabolism Connections:

    • Elucidation of the relationship between ascorbate recycling and iron absorption/utilization

    • Insights into disorders of iron metabolism where cytochrome b561 may play a role

    • Potential new approaches for treating conditions like anemia or iron overload

  • Neurodegenerative Disease Implications:

    • Understanding the role of cytochrome b561 in neurosecretory vesicles containing catecholamines

    • Potential connections to dopamine metabolism and Parkinson's disease

    • Links between ascorbate metabolism, oxidative stress, and neurodegeneration

  • Cancer Biology Insights:

    • Mechanisms by which altered ascorbate metabolism affects cancer progression

    • How dysregulation of cytochrome b561 contributes to changes in the tumor microenvironment

    • Potential for high-dose vitamin C therapy efficacy to be influenced by cytochrome b561 expression patterns

Researchers exploring these connections should design experiments that specifically probe the relationships between cytochrome b561 function, ascorbate metabolism, and the development or progression of these pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.