Recombinant Probable cytochrome c oxidase subunit 3 (ctaE)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Assembly Pathway

Recombinant ctaE production typically involves E. coli or yeast expression systems. Its assembly into functional COX requires interaction with metallochaperones:

  • CtaG: Assists in Cu<sub>B</sub> site metallation during early assembly .

  • Surf1c: Facilitates heme a insertion into subunit I (SUI) .

  • Assembly Intermediates:

    • Subcomplex I<sub>1</sub> (70 kDa): Initial association with CtaG.

    • Subcomplex I<sub>3</sub> (200 kDa): Interaction with Surf1c and SUII .

Applications in Research

Recombinant ctaE is widely used in:

  1. Structural Studies: Crystallization and cryo-EM to resolve COX architecture .

  2. Enzyme Kinetics: Measuring electron transfer efficiency under varying pH/temperature .

  3. Antibiotic Development: Targeting bacterial COX in pathogens like Mycobacterium .

Recent Research Findings

Key discoveries from 2024–2025 include:

  • Role in Supercomplex Formation: Mature ctaE-containing COX associates with respiratory complexes I and III to form supercomplexes (e.g., III<sub>4</sub>IV<sub>4</sub>) .

  • Mutational Analysis: Deletion of ctaE disrupts COX assembly, reducing heme aa<sub>3</sub> levels by >80% .

  • Chaperone Dependency: CtaE assembly requires cytochrome c as a redox partner, linking COX biogenesis to mitochondrial import pathways .

Challenges and Future Directions

Current limitations include instability in non-lyophilized forms and incomplete understanding of heme a insertion mechanics. Ongoing research focuses on:

  • Engineering thermostable variants for industrial applications .

  • Elucidating ctaE’s role in bacterial pathogenesis (e.g., Rickettsia spp.) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctaE; MAP_1932; Probable cytochrome c oxidase subunit 3; Cytochrome aa3 subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Target Names
ctaE
Target Protein Sequence
MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTARAQSGGKWPP PPTELNLYQAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYE YYHLMGHGTTIPGSAYGSVFYLATGFHDLHVTGGLVAFIFLLARTAMSKFTPAQATASIV VSYYWHFVDIVWIALFTVIYFIR
Uniprot No.

Target Background

Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is cytochrome c oxidase subunit 3 (ctaE) and how does it compare to other cytochrome c oxidase subunits?

Cytochrome c oxidase subunit 3 (ctaE) is a key transmembrane component of the terminal enzyme in the respiratory chain. It functions as part of the multi-subunit complex that catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen, coupled with proton pumping across the membrane. While subunits I and II contain the catalytic centers, subunit III plays a critical role in structural stability and possibly in proton transfer pathways .

In bacterial systems like Rhodobacter sphaeroides, the cbb3-type cytochrome c oxidase contains four nonidentical subunits where CcoN, CcoO, and CcoP form the catalytic core required for O2 reduction and cytochrome c oxidation. The fourth subunit (CcoQ) has been shown to protect the core complex from proteolytic degradation in the presence of oxygen . Understanding these structural relationships helps in designing recombinant expression strategies that maintain native functionality.

What experimental evidence supports the role of subunit 3 in oxidase stability?

Research with mutant strains lacking specific subunits has provided compelling evidence for the stabilizing role of oxidase subunits. Studies in Rhodobacter sphaeroides demonstrated that in the absence of subunit IV (CcoQ), exposure to oxygen leads to the loss of heme from the core complex, which subsequently destabilizes the cbb3 oxidase into a "degradable" form .

Similar mechanisms likely apply to ctaE, where its presence maintains the structural integrity of the complex under varying oxygen conditions. Deletion experiments have shown that the absence of this subunit affects other components, particularly under aerobic conditions. The CcoP subunit appears most severely affected when protective subunits are absent, suggesting interdependent stability mechanisms within the complex .

How can researchers distinguish between functional and structural roles of ctaE in experimental designs?

To differentiate between the functional and structural contributions of ctaE, researchers should implement a multi-faceted experimental approach:

These methodologies can be designed following sound experimental principles, including appropriate controls, randomization, and replication to ensure statistical validity .

What are the optimal expression systems for producing functional recombinant ctaE?

The expression of functional recombinant ctaE requires careful consideration of expression systems that can properly incorporate the protein into membranes and maintain its structural integrity. Based on current research practices:

Bacterial Expression Systems:

  • E. coli C41(DE3) or C43(DE3) strains: These "Walker strains" are engineered specifically for membrane protein expression and show reduced toxicity from membrane protein overexpression.

  • Rhodobacter species: Homologous expression in Rhodobacter sphaeroides or related bacteria offers advantages for proper folding and assembly into functional complexes .

Eukaryotic Expression Systems:

  • Yeast (P. pastoris or S. cerevisiae): These systems provide a eukaryotic membrane environment that may better mimic native conditions for mammalian cytochrome c oxidase components.

  • Insect cell lines: Baculovirus-infected insect cells offer high expression levels while maintaining complex post-translational modifications.

The choice between these systems should be guided by experimental objectives, with homologous expression generally providing better functional integration but potentially lower yields.

What purification strategy preserves both structure and activity of recombinant ctaE?

A successful purification strategy for recombinant ctaE must maintain the protein's native conformation within a membrane environment. The following methodological approach is recommended:

  • Gentle membrane solubilization:

    • Use mild detergents (DDM, LMNG, or digitonin) at minimal effective concentrations

    • Maintain physiological pH (7.2-7.4) and include glycerol (10-15%) as a stabilizer

  • Affinity chromatography:

    • Incorporate a small, cleavable tag (e.g., His6) at the C-terminus to minimize functional interference

    • Use immobilized metal affinity chromatography (IMAC) with gradient elution to separate intact complexes

  • Size exclusion chromatography:

    • Perform in detergent-containing buffers to separate complete complexes from individual subunits

    • Analyze fractions for both protein content and enzymatic activity

  • Activity preservation:

    • Include specific lipids (phosphatidylcholine, cardiolipin) during purification

    • Maintain reducing conditions to protect critical cysteine residues

The minimum length required for stability of comparable subunits (like CcoQ) has been determined to be approximately 48-50 amino acids at the amino-terminus , suggesting that truncation mutants should preserve at least this region.

How can researchers verify the proper assembly of ctaE into the cytochrome c oxidase complex?

Verification of proper ctaE integration into the cytochrome c oxidase complex requires multiple analytical approaches:

Biochemical Verification Methods:

  • Co-immunoprecipitation: Using antibodies against different subunits to confirm complex formation

  • Blue native PAGE: To visualize intact complexes and distinguish between assembled and unassembled proteins

  • Crosslinking studies: To map proximity relationships between ctaE and other subunits

Functional Verification Methods:

  • Oxygen consumption assays: Measuring the complex's ability to reduce O2

  • Cytochrome c oxidation kinetics: Quantifying electron transfer rates

  • Proton pumping assays: Assessing coupling efficiency between electron transfer and proton translocation

Structural Verification Methods:

  • Proteoliposome reconstitution: Testing function in artificial membrane systems

  • Circular dichroism spectroscopy: Confirming secondary structure characteristics

  • Limited proteolysis patterns: Comparing digestion fragments between native and recombinant complexes

Researchers should evaluate proteolytic resistance patterns, as previous studies have demonstrated that specific subunits protect the core complex from degradation by serine metalloproteases under aerobic conditions .

How should experiments be designed to study oxygen-dependent effects on ctaE function?

Designing experiments to investigate oxygen-dependent effects on ctaE requires careful consideration of oxygen control, experimental variables, and appropriate controls. The following methodological framework is recommended:

Experimental Design Elements:

  • Oxygen concentration control:

    • Use controlled atmosphere chambers or sealed reaction vessels with defined O2 concentrations

    • Implement continuous O2 monitoring using oxygen electrodes or optical sensors

    • Include multiple oxygen levels (0%, 1%, 5%, 21%, 100%) to establish dose-response relationships

  • Statistical design considerations:

    • Employ factorial experimental designs (particularly 2k factorial designs) to assess interaction effects between oxygen and other variables

    • Use randomization and blocking to control for nuisance variables

    • Determine appropriate sample sizes through power analysis to detect meaningful effects

  • Time-course elements:

    • Monitor stability and function over extended periods to capture degradation kinetics

    • Sample at logarithmic time intervals to efficiently capture early rapid changes and later slower effects

Methodological Table: Oxygen-Dependent Experimental Design

ParameterAnaerobic (0% O₂)Microaerobic (1-5% O₂)Aerobic (21% O₂)Hyperoxic (100% O₂)
Stability assessment0, 1, 3, 6, 12, 24, 48h0, 1, 3, 6, 12, 24, 48h0, 1, 3, 6, 12, 24, 48h0, 1, 3, 6, 12, 24, 48h
Activity measurementsEvery stability timepointEvery stability timepointEvery stability timepointEvery stability timepoint
Proteolytic sensitivityLimited proteolysisLimited proteolysisLimited proteolysisLimited proteolysis
Heme retention assayAbsorbance spectrumAbsorbance spectrumAbsorbance spectrumAbsorbance spectrum

The experimental design should include appropriate controls such as oxygen-insensitive proteins and known oxygen-sensitive variants to validate the methodology .

What statistical approaches are most appropriate for analyzing cytochrome c oxidase activity data?

The analysis of cytochrome c oxidase activity data requires rigorous statistical methods to account for experimental variability and identify significant effects. Based on experimental design principles, the following approaches are recommended:

  • Analysis of Variance (ANOVA):

    • Use multi-factor ANOVA to assess the effects of experimental variables and their interactions on enzyme activity

    • Implement repeated measures ANOVA for time-course experiments to account for within-subject correlations

  • Regression Analysis:

    • Apply linear regression models for continuous factors affecting enzyme activity

    • Use categorical (discrete) factor models when comparing different mutants or conditions

    • Implement response surface methodology for optimization experiments

  • Model Adequacy Assessment:

    • Perform residual analysis to verify normality and homoscedasticity assumptions

    • Use variance tests to identify potential heterogeneity

    • Calculate R² and adjusted R² statistics to quantify model fit

    • Conduct lack-of-fit tests to evaluate model adequacy

  • Multiple Comparison Methods:

    • Apply Tukey's HSD or Bonferroni corrections when comparing multiple experimental conditions

    • Use false discovery rate control for large-scale screening experiments

  • Confidence Interval Reporting:

    • Present results with appropriate confidence intervals rather than just p-values

    • Use graphical techniques to visualize data distributions and relationships

These statistical approaches should be selected based on the specific experimental design and implemented using appropriate statistical software packages.

How can researchers effectively design experiments to study the interaction between ctaE and other subunits?

Designing experiments to investigate subunit interactions within the cytochrome c oxidase complex requires a multidisciplinary approach that combines genetic, biochemical, and biophysical methods:

  • Genetic Approach - Deletion and Complementation:

    • Create deletion mutants lacking ctaE and assess effects on other subunits

    • Complement with wild-type or modified ctaE to restore function

    • Design series of C-terminal deletion derivatives to identify minimum functional domains

  • Crosslinking Studies:

    • Apply chemical crosslinkers with varying spacer lengths to map proximity relationships

    • Use photo-activatable crosslinkers for precise spatial resolution

    • Analyze crosslinked products using mass spectrometry to identify interaction sites

  • Biophysical Interaction Analysis:

    • Implement Förster Resonance Energy Transfer (FRET) with fluorescently labeled subunits

    • Apply Surface Plasmon Resonance (SPR) to measure binding kinetics

    • Use Isothermal Titration Calorimetry (ITC) to determine binding thermodynamics

  • Computational Modeling:

    • Perform molecular dynamics simulations of subunit interactions

    • Use protein-protein docking to predict interaction interfaces

    • Validate models with experimental mutagenesis of predicted interaction sites

The experimental design should incorporate proper controls, including non-interacting protein pairs and known interaction partners. Statistical analysis should apply appropriate methods for measuring the adequacy of models, including variance tests and lack-of-fit assessments .

How does the loss of heme from the core complex relate to ctaE stability and oxygen sensitivity?

The relationship between heme loss, complex stability, and oxygen sensitivity represents a sophisticated research area requiring specialized methodologies. Based on previous studies with related cytochrome oxidase subunits, a mechanistic model has emerged:

In the absence of stabilizing subunits like CcoQ (analogous to certain functions of ctaE), exposure to oxygen appears to trigger heme loss from the core complex, which then destabilizes the oxidase into a degradation-susceptible conformation . This process likely involves:

  • Initial oxygen-dependent modifications:

    • Potential oxidation of critical residues near heme-binding sites

    • Conformational changes that reduce heme affinity

    • Altered interactions between subunits that normally stabilize heme positioning

  • Cascading structural consequences:

    • Heme loss disrupts the protein's tertiary structure

    • Exposure of normally buried hydrophobic residues

    • Creation of recognition sites for proteolytic enzymes

  • Differential subunit vulnerability:

    • Studies with cbb3 oxidase demonstrated that CcoP subunit was most severely affected by the absence of stabilizing subunits under aerobic conditions

    • This suggests a hierarchy of stability within the complex

To investigate this phenomenon, researchers should employ:

  • Time-resolved spectroscopic methods to capture early events in heme dissociation

  • Site-directed mutagenesis of putative oxygen-sensing residues

  • Identification of specific proteases involved in the degradation process

  • Structural studies comparing oxygen-exposed and oxygen-protected complexes

What methodologies are most effective for studying electron transfer pathways involving ctaE?

Investigating electron transfer pathways in cytochrome c oxidase complexes containing ctaE requires specialized techniques that can capture the rapid and often quantum mechanical nature of these processes:

Experimental Approaches:

  • Time-resolved spectroscopy:

    • Ultrafast laser spectroscopy to track electron movements through the complex

    • Measurement of reaction kinetics at different temperatures to determine activation energies

    • Stopped-flow techniques for capturing intermediate states

  • Electrochemical methods:

    • Protein film voltammetry to determine redox potentials of individual centers

    • Direct electrochemistry of immobilized enzyme complexes

    • Measurement of electron transfer rates under controlled potential

  • Directed mutagenesis strategy:

    • Systematic modification of residues in proposed electron transfer pathways

    • Creation of electron transfer-impaired variants for mechanistic studies

    • Introduction of non-natural amino acids to probe specific interactions

  • Computational approaches:

    • Density functional theory calculations of electron transfer energetics

    • Molecular dynamics simulations of protein dynamics during electron transfer

    • Quantum mechanical/molecular mechanical (QM/MM) hybrid methods for reaction mechanism studies

Cytochrome c oxidase catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen, coupled with proton pumping across the membrane . Understanding ctaE's role in this process requires examining how structural features contribute to maintaining appropriate electron transfer distances and orientations.

What approaches can distinguish between proteolytic degradation and conformational changes in oxygen-sensitive variants?

Distinguishing between proteolysis and conformational alterations in oxygen-sensitive variants of cytochrome c oxidase requires a combination of biochemical, biophysical, and proteomic approaches:

Methodological Framework:

  • Proteolysis-specific detection:

    • Use activity-based protein profiling with protease-specific probes

    • Apply selective protease inhibitors to identify classes of proteases involved

    • Perform N-terminal sequencing of degradation products to identify cleavage sites

    • Compare degradation patterns in the presence of purified serine metalloproteases

  • Conformational change detection:

    • Monitor intrinsic tryptophan fluorescence changes in response to oxygen

    • Apply circular dichroism spectroscopy to detect secondary structure alterations

    • Use hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility

    • Perform limited proteolysis under native conditions to probe structural accessibility

  • Comparative stability assessment:

    • Direct comparison between mutants with deletion derivatives of varying lengths

    • Determination of minimum sequence requirements for stability (as demonstrated for CcoQ, where ~48-50 amino acids at the amino-terminus were required)

    • Time-course stability studies under aerobic versus anaerobic conditions

  • Integrated analytical pipeline:

    • Initial pulse-chase labeling to track protein fate

    • Followed by conformation-sensitive analysis

    • Concluding with proteomic identification of degradation products

These approaches should be implemented using a factorial experimental design to assess interactions between oxygen levels, protein variants, and proteolytic conditions.

How can researchers address the problem of variable oxygen sensitivity in different expression systems?

Variable oxygen sensitivity across expression systems represents a significant challenge when working with cytochrome c oxidase components. This methodological approach offers solutions:

System-Specific Optimization Strategies:

  • E. coli expression systems:

    • Implement controlled oxygen levels during growth and induction phases

    • Use specialized strains with enhanced membrane protein expression capabilities

    • Co-express chaperone proteins to assist proper folding

    • Design expression constructs that incorporate stabilizing domains

  • Eukaryotic expression systems:

    • Optimize media composition to include heme precursors and metal ions

    • Control culture redox potential through media additives

    • Adjust growth temperature to balance expression rate with folding efficiency

    • Apply mild induction conditions to prevent overwhelming cellular machinery

Universal Mitigation Approaches:

  • Media supplementation:

    • Add antioxidants (glutathione, ascorbate) to protect oxygen-sensitive components

    • Include specific lipids that stabilize membrane protein complexes

    • Supplement with excess heme to promote proper incorporation

  • Process modifications:

    • Harvest cells at optimal density before oxygen stress accumulates

    • Perform rapid purification under controlled atmosphere conditions

    • Include stabilizing agents throughout all processing steps

  • Expression construct design:

    • Incorporate oxygen-stabilizing domains from related proteins

    • Create fusion proteins with well-characterized stable partners

    • Include the minimum essential amino-terminal sequence (48-50 amino acids) required for stabilization

These approaches should be evaluated using a systematic experimental design that allows for identification of significant factors and their interactions .

What are the most effective methods for troubleshooting loss of activity during purification of ctaE-containing complexes?

Maintaining the activity of ctaE-containing complexes during purification requires systematic troubleshooting focused on preserving structural integrity and cofactor retention:

Activity Loss Diagnosis and Mitigation:

  • Heme loss detection and prevention:

    • Monitor absorption spectra at each purification step to track heme content

    • Add excess heme during cell disruption and early purification steps

    • Include stabilizing agents that prevent oxygen-induced heme dissociation

    • Maintain reducing conditions throughout purification

  • Detergent optimization:

    • Test multiple detergent types at various concentrations to identify optimal conditions

    • Consider detergent exchange during purification to match different process requirements

    • Implement systematic detergent screening with activity measurements

    • Include lipids that stabilize the native complex structure

  • Subunit dissociation prevention:

    • Track subunit composition at each purification step using western blotting

    • Adjust ionic strength to maintain subunit interactions

    • Consider mild crosslinking to preserve complex integrity

    • Implement blue native PAGE to monitor complex integrity

  • Proteolysis prevention:

    • Include protease inhibitor cocktails targeted to system-specific proteases

    • Maintain cold temperatures throughout purification

    • Minimize purification duration with optimized protocols

    • Consider the demonstrated role of serine metalloproteases in complex degradation

Decision Tree for Activity Loss Troubleshooting:

ObservationPotential CauseDiagnostic TestSolution
Loss of heme absorption peaksHeme dissociationCompare spectra before/after each stepAdd heme, reduce oxygen exposure
Decreased molecular weight on BN-PAGESubunit dissociationWestern blot for individual subunitsAdjust buffer conditions, reduce detergent concentration
Appearance of degradation productsProteolytic cleavageN-terminal sequencing of fragmentsAdd specific protease inhibitors
Inactivation without structural changesOxidative damageActivity in presence of reductantsInclude antioxidants throughout purification

How can conformational stability of recombinant ctaE be enhanced for structural studies?

Enhancing the conformational stability of recombinant ctaE for structural studies requires strategic modifications to both the protein and its environment:

Protein Engineering Approaches:

  • Stabilizing mutations:

    • Introduce disulfide bonds at strategic positions based on structural models

    • Replace flexible residues with more rigid alternatives

    • Optimize surface charge distribution to enhance solubility

    • Consider insights from related proteins where the amino-terminal region (48-50 amino acids) provides critical stabilization

  • Fusion partner strategy:

    • Incorporate well-folded, stable protein domains as fusion partners

    • Use split-GFP or split-intein systems to monitor proper folding

    • Design chimeric proteins with stable regions from homologous proteins

  • Co-expression approaches:

    • Express ctaE together with interacting subunits to promote proper complex formation

    • Co-express with specific chaperones that facilitate membrane protein folding

    • Implement simultaneous expression of assembly factors specific to cytochrome oxidases

Environmental Stabilization Methods:

  • Lipid nanodisc incorporation:

    • Reconstitute purified protein into defined lipid nanodiscs

    • Optimize lipid composition to match native membrane environment

    • Control nanodisc size to accommodate the entire complex

  • Stabilizing additives:

    • Screen various additives including glycerol, sugars, and amino acids

    • Identify specific lipids that enhance stability

    • Optimize buffer components for maximum thermal stability

    • Include cofactors that promote proper folding

  • Crystallization chaperones:

    • Utilize antibody fragments that lock the protein in stable conformations

    • Employ nanobodies selected against the properly folded protein

    • Consider designed ankyrin repeat proteins (DARPins) as crystallization aids

These approaches should be evaluated using thermal stability assays, limited proteolysis, and activity measurements to quantify improvements in conformational stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.