Recombinant Probable disulfide formation protein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant probable disulfide formation proteins are redox-active enzymes (e.g., thioredoxins, Dsb proteins, or ERV/ALR family members) expressed in host systems like Escherichia coli or yeast to facilitate correct disulfide bond formation in target proteins. They are essential for:

  • Structural stabilization: Disulfide bonds prevent aggregation and maintain tertiary structure .

  • Functional activity: Many therapeutic proteins (e.g., antibodies, cytokines) require disulfide bonds for receptor binding or enzymatic activity .

  • Oxidative folding: Catalyze thiol-disulfide exchange reactions in secretory pathways or engineered cytoplasmic compartments .

Key Mechanisms of Action

These proteins operate through conserved redox pathways:

Viral Pathway Example (Vaccinia Virus)

A three-component system (E10R, A2.5L, G4L) transfers disulfide bonds to virion membrane proteins :

  1. E10R: FAD-dependent sulfhydryl oxidase (ERV1/ALR family) uses oxygen as an electron acceptor.

  2. A2.5L: α-helical protein with CxxxC motif; stabilizes E10R and transfers disulfides to G4L.

  3. G4L: Thioredoxin-like protein oxidizes substrate proteins (e.g., L1R, F9L).

Intermediates: Disulfide-linked heterodimers (E10R-A2.5L, A2.5L-G4L) confirm sequential electron transfer .

Bacterial Pathway Example (E. coli Dsb System)

  • DsbA: Periplasmic oxidase introduces disulfides in substrate proteins.

  • DsbB: Reoxidizes DsbA via ubiquinone .

  • DsbC/DsbG: Isomerize incorrect disulfides .

Host System Optimization

HostKey EnzymesYield Improvement
E. coliDsbA, DsbC, thioredoxin2–5× for scFv antibodies
Komagataella phaffiiPdi1, Ero1Active IgG1 production
Saccharomyces cerevisiaePDI, Ero1pCorrect folding of insulin

Therapeutic Protein Case Studies

  • Bevacizumab (Anti-VEGF antibody): Shuffled disulfide bonds increased from 0.58% to 1.46% under stress, correlating with aggregation .

  • Rituximab (Anti-CD20 antibody): Stable disulfide bonds (e.g., Cys96-Cys224) resist stress-induced shuffling .

Common Issues

  • Misfolding: Incorrect disulfides reduce bioactivity (e.g., horseradish peroxidase requires DsbC/DsbA co-expression) .

  • Cytoplasmic Reduction: E. coli cytoplasm degrades disulfides; solutions include:

    • Strain Engineering: trxB/gor mutants (e.g., SHuffle®) enable cytoplasmic disulfide formation .

    • Fusion Partners: Thioredoxin or DsbA fusions enhance solubility .

Analytical Methods

  • LC-MS/MS: Detects shuffled bonds (e.g., Cys133-Cys148 in rituximab) .

  • Non-Reducing SDS-PAGE: Identifies interchain vs. intrachain disulfides .

Emerging Research Directions

  • Orthogonal Systems: Co-expression of viral redox proteins (e.g., vaccinia E10R) in mammalian cells for complex glycoproteins .

  • AI-Driven Design: Predicting cysteine pairing using AlphaFold2 and Rosetta .

  • Stress Resilience: Engineering Komagataella phaffii Ero1-Pdi1 complexes to withstand unfolded protein response .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare the protein according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Pseudomonas resinovorans
Target Protein Sequence
MNPQPSGMTWNLLLLTWLVALISTLSALFIGEVMGQAPCVLCWFQRAFMFPLTVILAIAC YRSDFTVWRYALPLTVIGAALAFVHTLLYAGLIPQPIQPCTATGPSCSGAGMTLFGVVPL PALALFAFIIIAILLIIIRRRTTP
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological significance of disulfide bonds in proteins?

Disulfide bonds play a critical role in protein stability and function by covalently connecting cysteine residues within protein structures. These bonds contribute to tertiary protein structure, providing mechanical strength and conformational stability that can be essential for biological activity. In prokaryotes, disulfide bonds are primarily found in secreted or periplasmic proteins, while in eukaryotes, they commonly occur in proteins processed through the endoplasmic reticulum. The formation of correct disulfide bonds is often rate-limiting in protein folding processes and directly impacts the functionality of numerous enzymes, antibodies, hormones, and other bioactive proteins. Disulfide bonds can also function as regulatory switches in some proteins, being reduced and oxidized in response to cellular conditions .

How do disulfide bonds form naturally in bacterial systems?

In bacterial systems, particularly Gram-negative bacteria like E. coli, disulfide bond formation occurs primarily in the periplasmic space, which provides an oxidizing environment conducive to this process. The formation is enzymatically catalyzed by the Dsb (disulfide bond) protein system, which includes at least five key members: DsbA, DsbB, DsbC, DsbD, and DsbG. The process begins with DsbA, a soluble monomer protein that donates its disulfide bond to newly synthesized polypeptides through hydrophobic interactions with partially unfolded proteins. DsbA is then regenerated by transferring electrons to DsbB, an integral membrane protein that maintains DsbA in its active state. This DsbA/DsbB-mediated oxidative process efficiently creates disulfide bonds, though not always in the correct configuration. The quality control mechanism involves DsbC and DsbG, which function as isomerases that rearrange incorrect disulfide pairings. These isomerases are kept reduced by DsbD, which transfers electrons from the cytoplasmic thioredoxin system across the inner membrane .

What are the challenges in expressing recombinant proteins with disulfide bonds in E. coli?

The expression of recombinant proteins with disulfide bonds in E. coli faces several significant challenges:

  • Compartmentalization issues: The reducing environment of the bacterial cytoplasm prevents stable disulfide bond formation, necessitating translocation to the periplasm through a limited number of membrane gates, which can become a bottleneck.

  • Oxidation efficiency: Spontaneous protein oxidation in extracytoplasmic compartments is extremely slow and incompatible with cell activity, requiring efficient enzymatic catalysis.

  • Incorrect disulfide pairing: The highly efficient DsbA/DsbB system may result in incorrect cysteine pairing, trapping proteins in non-native conformations if isomerase activity (DsbC) is insufficient.

  • Protein-specific requirements: Different proteins may require different combinations of Dsb proteins for optimal folding, with proteins containing non-consecutive disulfides typically being more dependent on DsbC activity.

  • Translocation challenges: Successfully directing nascent polypeptides through the inner membrane introduces a delicate step, as metastable precursors may accumulate in the cytoplasm .

What distinguishes consecutive from non-consecutive disulfide bonds, and why is this important?

Consecutive disulfide bonds form between cysteine residues that are adjacent in the primary sequence, while non-consecutive disulfide bonds connect cysteines that are distant in the linear sequence but brought into proximity by protein folding. This distinction is critically important for recombinant protein expression strategies because:

  • DsbA couples cysteines as soon as they emerge during translation, efficiently forming bonds between consecutive residues.

  • Proteins with non-consecutive disulfides often require DsbC isomerase activity to achieve correct folding, as DsbA may initially create incorrect disulfide bonds.

  • The correlation between the presence of non-consecutive disulfides and DsbC-dependence has been demonstrated for both eukaryotic and bacterial proteins.

  • Understanding the disulfide bond pattern of a target protein helps in designing the appropriate expression system and determining whether to overexpress specific Dsb proteins to enhance yield of correctly folded protein .

What are the primary expression strategies for producing disulfide-bonded proteins in E. coli?

The primary strategies for expressing disulfide-bonded proteins in E. coli include:

  • Periplasmic expression: Directing the translated polypeptides to the bacterial periplasm using signal sequences, taking advantage of the oxidizing environment and native Dsb machinery.

  • Co-expression of folding catalysts: Overexpressing components of the Dsb system (DsbA, B, C, D) to enhance the formation of correct disulfide bonds. The choice of which components to overexpress depends on the specific structural features of the target protein.

  • Engineering of the host redox environment: Modifying the redox potential of the periplasm to create conditions more favorable for specific disulfide bond formation patterns.

  • Heterologous oxidoreductase expression: Introducing eukaryotic oxidoreductases such as human or yeast PDI into the bacterial periplasm, which has proven successful in restoring function in dsbA mutants.

  • Fusion protein approaches: Creating fusions with DsbA or other Dsb proteins to enhance the solubility and correct folding of the target protein .

How does the choice of Dsb protein overexpression impact recombinant protein yields?

The impact of Dsb protein overexpression on recombinant protein yields varies significantly depending on the structural characteristics of the target protein:

Protein PropertyRecommended Dsb OverexpressionExpected Impact on YieldExample Proteins
Only consecutive disulfidesDsbA, DsbABSignificant yield increaseBovine enterokinase, human pro-insulin
Contains non-consecutive disulfidesDsbC, DsbCDCritical for correct foldingRagi bifunctional inhibitor, brain-derived neurotrophic factor
Complex disulfide patternDsbA+DsbC, DsbCDSynergistic improvementNerve growth factor beta, horseradish peroxidase
Multiple overlapping disulfidesDsbC (primarily)Prevents non-native intermediatesRagi bifunctional inhibitor, scFvs

Research has shown that DsbC activity is often the limiting factor for correct folding of proteins with complex disulfide patterns. Overexpression of DsbA alone can sometimes lead to the accumulation of misfolded intermediates for proteins with non-consecutive disulfides, while DsbC overexpression can significantly enhance the yield of correctly folded protein. For some proteins, the synergistic effect of overexpressing multiple Dsb components provides the best results .

What alternatives to E. coli exist for recombinant expression of disulfide-bonded proteins?

While E. coli remains the most widely used host for recombinant protein expression, several alternatives offer advantages for disulfide-bonded proteins:

  • Yeast systems (Saccharomyces cerevisiae, Pichia pastoris): Provide eukaryotic oxidizing environment in the endoplasmic reticulum and secretory pathway, along with native PDI activity.

  • Insect cell lines: Contain machinery for more complex post-translational modifications including disulfide bond formation, particularly suitable for eukaryotic proteins.

  • Mammalian cell cultures: Offer the most authentic environment for complex human proteins, including correct disulfide bond formation and other modifications.

  • Gram-positive bacteria (e.g., Bacillus brevis): Some studies have shown successful engineering with human disulfide isomerase, resulting in functional restoration and yield improvement.

  • Cell-free expression systems: Allow controlled redox conditions and the addition of specific chaperones and oxidoreductases to guide proper folding.

The choice depends on the complexity of the target protein, required yield, cost considerations, and whether additional post-translational modifications beyond disulfide bonds are needed .

How can researchers detect incorrect disulfide bond formation in recombinant proteins?

Detection of incorrect disulfide bond formation requires a combination of analytical approaches:

  • Mass spectrometry-based mapping: Using proteolytic digestion followed by MS/MS analysis to identify the location of disulfide bridges. Comparison with the expected pattern reveals mismatches.

  • Activity assays: Measuring biological activity as an indirect indicator of correct folding and disulfide bonding. Reduced activity often correlates with incorrect disulfide formation.

  • Single molecule techniques: Atomic Force Microscope (AFM) approaches can measure the kinetics of protein oxidation and folding, enabling the detection of mixed disulfide complexes at the single molecule level.

  • Protease susceptibility: Incorrectly folded proteins often show altered susceptibility to limited proteolysis, providing a diagnostic tool for misfolded states.

  • Spectroscopic methods: Circular dichroism, fluorescence spectroscopy, and NMR can reveal structural abnormalities resulting from incorrect disulfide formation.

Recent advances in single molecule techniques have enabled independent measurements of disulfide formation and protein folding, demonstrating that non-native disulfides formed early in the folding pathway can trigger misfolding .

What strategies can mitigate disulfide scrambling during protein storage and handling?

Disulfide scrambling, the rearrangement of disulfide bonds leading to inactive conformations, is a significant challenge for protein stability. Several strategies can mitigate this issue:

  • Optimal pH control: Maintaining pH away from values that promote thiol-disulfide exchange (typically avoiding pH > 8).

  • Temperature management: Storing proteins at lower temperatures (4°C or -20°C/-80°C) to slow down scrambling reactions.

  • Buffer composition: Including stabilizing agents such as glycerol, sucrose, or specific amino acids that protect the native conformation.

  • Oxygen exclusion: Removing oxygen from storage buffers and container headspace to prevent oxidation-induced scrambling.

  • Addition of free thiol scavengers: Incorporating compounds that react with free thiols to prevent their participation in scrambling reactions.

  • Lyophilization with appropriate excipients: Freeze-drying in the presence of stabilizers can maintain the native disulfide configuration.

The selection of appropriate strategies depends on the specific protein characteristics and intended storage duration .

How do the mechanisms of PDI and DsbC differ in disulfide isomerization?

The mechanisms of PDI (Protein Disulfide Isomerase) in eukaryotes and DsbC in prokaryotes share functional similarities but differ in key aspects:

FeaturePDI (Eukaryotic)DsbC (Prokaryotic)
Cellular locationEndoplasmic reticulumPeriplasm
Domain structureFour thioredoxin-like domains (a, b, b', a')Dimeric structure with two thioredoxin-like domains
Active siteCGHC motif in a and a' domainsCGYC motif
Substrate bindingHydrophobic pocket in b' domainHydrophobic surface in the cleft between monomers
Reduction mechanismMaintained in part-oxidized state by oxidoreductin (Ero1)Kept reduced by DsbD, which transfers electrons from cytoplasmic thioredoxin
Folding assistanceContains chaperone activity independent of redox activityPrimarily functions as an isomerase but also shows chaperone activity
Mode of actionCan act both as an oxidase and isomerasePredominantly functions as an isomerase

Despite low sequence homology, a marked structural similarity exists between these enzymes, which explains why human PDI can functionally replace DsbC in E. coli systems. Recent single-molecule studies suggest that PDI acts as a placeholder that allows the substrate to guide the pairing of cysteines into native disulfide bonds, a mechanism that may also apply to DsbC .

What molecular processes determine whether DsbA or DsbC is more critical for proper folding of a particular protein?

The relative importance of DsbA (oxidase) versus DsbC (isomerase) for proper protein folding is determined by several molecular factors:

  • Disulfide connectivity pattern: Proteins with only consecutive disulfide bonds typically rely more on DsbA activity, while those with non-consecutive or complex disulfide networks depend more heavily on DsbC.

  • Folding kinetics: If protein folding proceeds rapidly enough to bring non-consecutive cysteines into proximity before DsbA can catalyze incorrect bonds, DsbC becomes less critical.

  • Local sequence context: The reactivity of cysteine residues is influenced by neighboring amino acids, affecting the propensity for incorrect disulfide formation by DsbA.

  • Structural complexity: More complex protein structures with multiple domains tend to benefit more from DsbC activity to resolve incorrectly formed disulfides during the folding process.

  • Temporal exposure of cysteines: The order in which cysteine residues emerge from the translocon during secretion impacts their availability for oxidation by DsbA.

What experimental approaches can determine the optimal Dsb protein system for a specific recombinant protein?

Determining the optimal Dsb protein system for a specific recombinant protein involves several experimental approaches:

  • Combinatorial co-expression analysis: Systematically co-expressing the target protein with different combinations of Dsb proteins (DsbA, B, C, D, or DsbAB, DsbCD) and analyzing yield and activity.

  • Disulfide mapping validation: Using mass spectrometry to identify correctly formed disulfide bonds under different expression conditions.

  • Surrogate activity assays: Developing rapid activity tests that can serve as proxies for correct disulfide bond formation.

  • Reporter fusion systems: Creating fusions with easily measurable reporter proteins (e.g., alkaline phosphatase) whose activity depends on correct disulfide formation.

  • Redox state analysis: Using alkylation-based methods to determine the oxidation state of cysteines in the recombinant protein under different expression conditions.

  • Mutational analysis: Creating cysteine-to-serine mutations to identify which disulfide bonds are most critical for correct folding and which may require specific Dsb proteins.

These approaches should be combined with structural analysis of the target protein to predict whether it contains consecutive or non-consecutive disulfide bonds, which serves as a preliminary indicator of DsbA or DsbC dependence .

How can single-molecule techniques advance understanding of disulfide bond formation?

Single-molecule techniques offer unique insights into disulfide bond formation processes that are not accessible through bulk measurements:

  • Direct observation of reaction intermediates: Atomic Force Microscopy (AFM) allows researchers to observe mixed disulfide complexes between substrate proteins and oxidoreductases.

  • Time-resolved measurements: By using force pulses at different time intervals, researchers can track the progression of oxidative folding events.

  • Independent measurement of oxidation and folding: These techniques enable the separation of disulfide formation from protein folding events, revealing their temporal relationship.

  • Force-dependent enzyme kinetics: By applying controlled forces to substrate proteins, researchers can study how mechanical tension affects enzymatic disulfide bond formation.

  • Molecular mechanism elucidation: Single-molecule approaches have revealed that PDI and potentially other oxidoreductases act as placeholders that allow the substrate's folding to guide proper disulfide pairing.

Recent studies using AFM to mimic the initial stages of oxidative folding have provided evidence that non-native disulfides form early in the folding pathway and can trigger misfolding, while PDI domains favor native disulfides by catalyzing oxidation at a late stage of folding .

What in silico methods can predict disulfide bond patterns in novel proteins?

Several computational approaches can predict disulfide bond patterns in novel proteins:

Method TypeDescriptionAccuracy RangeLimitations
Sequence-basedUses position-specific scoring matrices and evolutionary information60-80%Limited by availability of homologous sequences
Structure-basedAnalyzes 3D models to identify cysteines with appropriate proximity75-90%Requires accurate structural prediction
Machine learningEmploys neural networks and random forests trained on known patterns70-85%Performance depends on training dataset diversity
Hybrid approachesCombines sequence, structure, and physicochemical features80-95%Computationally intensive
Coevolution analysisIdentifies co-evolving cysteine residues as potential partners65-85%Requires large multiple sequence alignments

How can synthetic biology approaches enhance disulfide bond formation in recombinant proteins?

Synthetic biology offers several innovative approaches to enhance disulfide bond formation:

  • Engineered oxidative cytoplasm: Strains like SHuffle® with mutations in reductases (trxB, gor) and expression of cytoplasmic DsbC enable disulfide formation in the E. coli cytoplasm.

  • Orthogonal redox systems: Introduction of non-native oxidoreductases that operate independently of the host's redox machinery.

  • Compartmentalization strategies: Creating synthetic organelles or membrane-bound compartments with oxidizing environments within bacterial cells.

  • Genetic circuit integration: Developing feedback-regulated systems that adjust oxidoreductase expression based on folding status of the target protein.

  • Non-natural amino acid incorporation: Using selenocysteine or other cysteine analogs with altered redox properties to facilitate specific disulfide patterns.

  • Directed evolution of Dsb proteins: Engineering oxidoreductases with altered substrate specificity or enhanced activity for particular protein classes.

These approaches represent the frontier of recombinant protein expression technology and have the potential to significantly improve yields of correctly folded disulfide-containing proteins .

What role does co-translational disulfide bond formation play in protein folding and how can it be leveraged?

Co-translational disulfide bond formation occurs during protein synthesis while the nascent chain is still attached to the ribosome, playing several important roles:

  • Prevention of misfolding: Early formation of key disulfide bonds can prevent the polypeptide from exploring incorrect folding pathways.

  • Folding compartmentalization: Sequential formation of disulfide bonds can compartmentalize the folding process, allowing complex proteins to fold in modules.

  • Kinetic advantage: Co-translational disulfide formation can be faster than post-translational reorganization, enhancing folding efficiency.

  • Reduced aggregation: Proper stabilization of partially synthesized proteins reduces aggregation propensity.

These insights can be leveraged in recombinant expression systems by:

  • Optimizing translation rates: Adjusting codon usage to control the timing of cysteine emergence from the ribosome tunnel.

  • Engineering signal sequences: Designing signal peptides that optimize the timing of translocation into oxidizing compartments.

  • Co-expression of translocation-associated oxidoreductases: Ensuring oxidative enzymes are present at the site of protein emergence.

  • Ribosome display techniques: Using cell-free systems where nascent chains remain ribosome-associated during disulfide formation.

Recent single-molecule studies suggest a model for co-translational oxidative folding wherein PDI acts as a placeholder that is relieved by the pairing of cysteines caused by substrate folding, which could inform new expression strategies .

How might advances in computational protein design impact recombinant disulfide-bonded protein production?

Advances in computational protein design are poised to revolutionize recombinant disulfide-bonded protein production in several ways:

  • De novo disulfide design: Algorithms can now predict optimal positions for introducing disulfide bonds to enhance stability without disrupting function.

  • Folding pathway engineering: Computational models can predict and optimize folding pathways to favor correct disulfide formation.

  • Expression host customization: In silico modeling of host cell redox environments can guide the selection or engineering of expression systems optimal for specific proteins.

  • Codon optimization strategies: Advanced algorithms incorporate disulfide bond formation kinetics into codon optimization, controlling the timing of cysteine exposure.

  • Chaperone interaction prediction: Models predicting interactions between target proteins and folding catalysts can guide co-expression strategies.

  • Misfolding hotspot identification: Computational approaches can identify sequence regions prone to misfolding due to incorrect disulfide formation, enabling targeted mutations.

These computational approaches, when integrated with experimental validation, promise to greatly reduce the empirical optimization currently required for successful expression of disulfide-rich proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.