Recombinant Probable disulfide formation protein C 1 (bdbC1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Probable Disulfide Formation Protein C 1 (bdbC1) is a bacterial oxidoreductase critical for catalyzing disulfide bond formation in secreted or membrane-associated proteins. These bonds stabilize tertiary structures and ensure functional integrity, particularly in Gram-positive bacteria such as Bacillus cereus and Bacillus anthracis . The protein is part of the Bdb (Bacillus disulfide bond) family, which includes paralogs like BdbD, and functions analogously to the Dsb system in E. coli .

Active Site and Mechanism

  • Catalytic Motif: Contains a thioredoxin-like fold with a reactive CXXC (Cys-Pro-His-Cys) motif responsible for disulfide interchange .

  • Redox Partners: BdbC1 interacts with BdbD (a thiol-disulfide oxidoreductase) to maintain redox balance during protein folding .

Biological Context

  • Substrates: Essential for folding extracellular proteins like the ComCG pseudopilus involved in bacterial competence and sublancin 168, an antibiotic with disulfide bonds .

  • Gene Clusters: Located within operons encoding structural components of secretion systems (e.g., competence-related genes in Bacillus subtilis) .

Recombinant Production

Recombinant bdbC1 is expressed in heterologous systems such as E. coli, yeast, or mammalian cells, with yields and purity tailored for research applications.

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE verified)
Expression TagsN-terminal 10xHis tag (Cusabio CSB-CF352837BQN)
SequenceFull-length (1–139 aa) with conserved CXXC motif

Applications in Research

  • Protein Engineering: Used to study disulfide bond dynamics in heterologous protein production .

  • Antibiotic Development: Insights into sublancin 168 biosynthesis inform strategies for engineering disulfide-rich antimicrobial peptides .

  • Biosimilar Characterization: Disulfide bond analysis (e.g., bevacizumab vs. rituximab) leverages oxidoreductase activity for quality control .

Mechanistic Insights

  • Redox Potential: BdbC1 exhibits high redox potential (-120 mV), enabling efficient oxidation of substrate thiols .

  • Synergy with Chaperones: Co-expression with DsbC/DsbG homologs enhances folding of proteins with nonconsecutive disulfide bonds .

Comparative Systems

OrganismOxidoreductaseRedox PartnerCofactor
Bacillus subtilisBdbC1BdbDUbiquinone
E. coliDsbADsbBUbiquinone
Human ERPDIEro1FAD

Challenges and Solutions

  • Misfolding Risks: Overexpression of BdbC1 without isomerases (e.g., BdbD) can lead to non-native disulfides. Co-expression systems mitigate this .

  • Scalability: Cell-free expression (e.g., Cusabio’s platform) improves yield for structural studies .

Future Directions

  • Structural Studies: Cryo-EM or crystallography to resolve substrate-binding interfaces.

  • Industrial Biotechnology: Optimizing BdbC1 variants for high-throughput disulfide bond formation in therapeutic proteins .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
bdbC1; BA_0758; GBAA_0758; BAS0722; Probable disulfide formation protein C 1; Disulfide oxidoreductase C 1; Thiol-disulfide oxidoreductase C 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
bdbC1
Target Protein Sequence
MGREKKQEYALFTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVVK KDYRIASYSLPIASIGACISLYHYVIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links

KEGG: ban:BA_0758

STRING: 260799.BAS0722

Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Probable disulfide formation protein C 1 (bdbC1)?

Recombinant Probable disulfide formation protein C 1 (bdbC1) is a protein involved in the disulfide bond formation pathway in Bacillus anthracis. It functions as a disulfide oxidoreductase (also called thiol-disulfide oxidoreductase), facilitating the formation of structural disulfide bonds essential for protein stability and function. This protein belongs to a family of disulfide bond formation proteins that ensure the correct folding of secreted proteins in prokaryotes, similar to the DsbA/DsbB system found in E. coli .

What expression systems are most effective for producing functional recombinant bdbC1?

For optimal expression of functional recombinant bdbC1, researchers should consider:

  • Fusion protein approach: Using maltose-binding protein (MBP) as a fusion partner has proven successful for producing soluble and biologically active recombinant disulfide-containing proteins. This approach prevents the formation of inclusion bodies and improves proper folding .

  • Choice of expression host: E. coli strains engineered for disulfide bond formation such as Origami or SHuffle are recommended as they have modified redox environments that facilitate proper disulfide bond formation .

  • Expression conditions: Lower temperatures (16-25°C), reduced inducer concentrations, and extended expression times generally yield better results for disulfide-rich proteins .

  • Periplasmic targeting: Directing bdbC1 to the periplasmic space using appropriate leader peptides can improve correct disulfide bond formation, as the periplasm provides a more oxidizing environment than the cytoplasm .

Table 1: Comparison of Expression Systems for Disulfide-Containing Proteins

Expression SystemAdvantagesDisadvantagesSuitable for bdbC1
Cytoplasmic expression (standard)Simple protocol, high yieldOften results in misfolded proteinNot recommended
Periplasmic targetingNatural oxidizing environmentLower yields, requires optimizationHighly recommended
MBP fusionEnhances solubility, aids purificationMay affect protein activityRecommended (proven successful)
Co-expression with chaperonesImproves foldingIncreases complexityPotentially beneficial

What strategies can overcome challenges in expressing disulfide bond-containing proteins like bdbC1?

Several strategies can address challenges in expressing disulfide-rich proteins like bdbC1:

  • Modulation of expression level: Tuning the translation rate by modifying the Shine-Dalgarno sequence or the translational initiation region (approximately twenty nucleotides downstream of the initiation codon) can prevent overwhelming the cellular folding machinery .

  • Co-expression with folding catalysts: Co-expressing chaperones and foldases such as DnaKJE, DsbA, DsbC, or Ppi can significantly enhance correct disulfide bond formation and proper folding .

  • Leader peptide selection: The choice of leader peptide for periplasmic targeting is critical. Highly hydrophobic leader sequences may engage the SRP pathway for co-translational translocation, preventing premature folding in the cytoplasm .

  • Sequential purification steps: Using affinity chromatography followed by size exclusion under conditions that preserve native disulfide bonds can improve yield of correctly folded protein .

How can researchers verify the correct formation of disulfide bonds in recombinant bdbC1?

Verification of correct disulfide bond formation requires:

  • Mass spectrometric analysis: Matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry can determine disulfide linkages by analyzing the differential mobility of disulfide-linked peptide ions under reducing and non-reducing conditions .

  • In vitro kinase assays: Functional assays can assess whether the recombinant protein retains its biological activity, indirectly confirming correct disulfide bond formation .

  • Site-directed mutagenesis: Mutating specific cysteine residues to serine and analyzing the functional consequences can identify critical disulfide bonds essential for protein activity .

  • Differential alkylation techniques: Sequential labeling of free thiols before and after reduction of disulfide bonds, followed by mass spectrometric analysis, can map the disulfide connectivity pattern.

What experimental designs are most appropriate for studying bdbC1 function?

For studying bdbC1 function, several single-subject experimental designs can be employed:

  • Reversal/withdrawal design (A-B-A): This design establishes experimental control by measuring baseline activity (A), introducing bdbC1 or an intervention affecting bdbC1 (B), and then returning to baseline conditions (A). This approach clearly demonstrates the effect of bdbC1 on disulfide bond formation in target substrates .

  • Multiple baseline design: This approach allows testing bdbC1's effects across different substrate proteins or experimental conditions simultaneously, providing robust evidence for its specific role in disulfide bond formation .

  • Changing criterion design: Particularly useful for studying the progressive effects of bdbC1 concentration or activity on disulfide bond formation efficiency in various substrates .

These designs help establish prediction, verification, and replication - essential components for demonstrating experimental control in single-subject research .

How does bdbC1 compare functionally to other disulfide bond formation proteins across different prokaryotic species?

Comparative analysis reveals:

Table 2: Functional Comparison of Disulfide Bond Formation Proteins

ProteinOrganismPrimary FunctionRecycling MechanismDistinctive Features
bdbC1B. anthracisDisulfide oxidoreductaseNot fully characterizedActive in pathogen virulence factor maturation
DsbAE. coliPrimary disulfide catalystRecycled by DsbBHighly efficient oxidase, broad substrate range
DsbCE. coliDisulfide isomeraseRecycled by DsbDRepairs non-native disulfides, dimeric structure
VKORMycobacteriaMembrane-bound oxidoreductaseMenaquinone-dependentAlternative to DsbB in some bacteria

The distinct characteristics of bdbC1 likely reflect adaptations to B. anthracis' ecological niche and pathogenic lifestyle. Unlike E. coli's DsbA which operates in the periplasm, bdbC1 functions in a Gram-positive bacterium lacking a traditional periplasmic space, suggesting a different cellular localization and potentially distinct substrate recognition mechanisms .

What is the relationship between bdbC1 function and bacterial pathogenesis?

While specific information on bdbC1's role in pathogenesis is limited in the provided search results, extrapolation from related systems suggests:

  • Virulence factor maturation: bdbC1 likely ensures proper folding of secreted virulence factors containing disulfide bonds, critical for bacterial pathogenesis.

  • Structural stability: Many bacterial toxins and adhesins require disulfide bonds for stability in the extracellular environment. bdbC1 may be essential for maintaining the structural integrity of these factors in B. anthracis.

  • Stress resistance: Proper disulfide bond formation contributes to protein stability under stress conditions encountered during infection, potentially enhancing bacterial survival within the host.

  • Potential therapeutic target: Given its potential importance in virulence factor maturation, bdbC1 could represent a novel target for antimicrobial development.

What strategies can researchers use to study bdbC1 substrate specificity?

To investigate substrate specificity:

  • Proteomics approach: Compare the secretome profiles of wild-type and bdbC1-deficient strains to identify proteins with altered disulfide bond formation.

  • In vitro oxidation assays: Measure the rate of bdbC1-catalyzed oxidation of various substrate peptides or proteins containing different disulfide bond arrangements.

  • Yeast two-hybrid or pull-down assays: Identify direct protein-protein interactions between bdbC1 and potential substrate proteins.

  • Site-directed mutagenesis: Modify the active site residues of bdbC1 to alter substrate specificity, helping to define the molecular determinants of recognition.

  • Comparative genomics: Analyze co-evolution patterns between bdbC1 and potential substrate proteins across different bacterial species to identify conserved interaction partners.

How can researchers develop effective genetic models to study bdbC1 function?

Effective genetic manipulation approaches include:

  • CRISPR-Cas9 genome editing: For precise deletion, insertion, or point mutations in the bdbC1 gene to study the effects on bacterial physiology and virulence.

  • Conditional expression systems: Using inducible promoters to control bdbC1 expression levels, allowing for temporal studies of its function and avoiding potential lethal effects of complete knockout.

  • Complementation studies: Reintroducing wild-type or mutant versions of bdbC1 into knockout strains to confirm gene function and identify critical residues.

  • Reporter gene fusions: Creating translational fusions with fluorescent proteins to track bdbC1 localization and expression patterns under different conditions.

  • Heterologous expression: Expressing bdbC1 in related species lacking endogenous disulfide formation systems to assess its function in isolation from redundant pathways .

How should researchers interpret contradictory results in bdbC1 functional studies?

When facing contradictory results, researchers should consider:

  • Experimental conditions: Differences in pH, temperature, redox environment, or buffer components can significantly impact disulfide bond formation activities. The oxidizing environment is particularly critical for proper function of disulfide-forming proteins .

  • Protein context effects: The presence or absence of fusion tags, leader peptides, or purification methods can influence protein behavior. For instance, DsbA fusion has been shown to increase the accumulation of some disulfide-bonded proteins but can lead to non-native intermediates for others .

  • Redundant pathways: Many bacteria possess multiple disulfide bond formation pathways with overlapping functions. The presence of alternative pathways can mask phenotypes in single gene knockouts .

  • Substrate-specific effects: bdbC1 may process different substrates with varying efficiencies. For example, DsbC is the key foldase for proteins with multiple disulfide bonds, while DsbA may be sufficient for proteins with simple disulfide patterns .

  • Expression level effects: Overexpression of disulfide bond formation proteins can lead to non-physiological interactions and potentially misleading results. Modulation of expression levels can significantly impact the outcome of recombinant protein production .

What statistical approaches are most appropriate for analyzing bdbC1 catalytic activity data?

Appropriate statistical approaches include:

  • Enzyme kinetics analysis: Applying Michaelis-Menten kinetics to determine KM and kcat values for different substrates, allowing quantitative comparison of substrate preferences.

  • Multiple comparison tests: When comparing bdbC1 activity across different conditions or substrates, ANOVA with appropriate post-hoc tests (e.g., Tukey's HSD) should be used to control for family-wise error rates.

  • Time series analysis: For studies examining disulfide bond formation over time, repeated measures ANOVA or mixed-effects models are appropriate.

  • Statistical control approaches: When studying bdbC1 in single-subject experimental designs, visual analysis methods combined with statistical techniques like percentage of non-overlapping data points (PND) or improvement rate difference (IRD) can quantify intervention effects .

  • Multivariate analysis: When examining multiple parameters simultaneously (e.g., activity across different substrates, pH values, and temperatures), principal component analysis or other dimensionality reduction techniques can help identify patterns.

How does understanding bdbC1 function contribute to protein engineering applications?

Knowledge of bdbC1 contributes to protein engineering through:

  • Optimized expression systems: Insights into disulfide bond formation pathways can lead to improved expression systems for challenging recombinant proteins, particularly those containing multiple disulfide bonds .

  • Synthetic disulfide bond formation machineries: Understanding the molecular mechanisms of bdbC1 can inform the design of synthetic disulfide bond formation systems for industrial or pharmaceutical protein production .

  • Strain engineering: Creating E. coli or other bacterial strains with enhanced disulfide bond formation capabilities by introducing or modifying components of the disulfide bond formation machinery .

  • Fusion protein strategies: The successful use of fusion partners (like MBP) with disulfide-containing proteins provides strategies for improving the production of other challenging proteins .

  • In vitro folding technologies: Mechanistic insights into disulfide bond formation can improve in vitro protein folding protocols for biopharmaceutical manufacturing.

What are the implications of bdbC1 research for understanding bacterial adaptation to different environments?

Research on bdbC1 provides insights into bacterial adaptation through:

  • Redox homeostasis: Understanding how bacteria maintain redox balance in different environments and how disulfide bond formation systems have evolved to function under various conditions .

  • Thermal adaptation: Analysis of disulfide bond formation proteins in thermophiles versus mesophiles reveals adaptations that enable protein stability at different temperatures .

  • Pathogen-host interactions: The role of disulfide bond formation in virulence factor production illuminates mechanisms of host-pathogen co-evolution.

  • Stress responses: Insights into how disulfide bond formation systems respond to oxidative stress, pH changes, and other environmental challenges faced by bacteria.

  • Evolutionary diversity: Comparative analysis of disulfide bond formation pathways across different prokaryotic species, including the recently discovered systems in some Archaea, reveals evolutionary adaptation strategies .

What are the most promising approaches for structure-function studies of bdbC1?

Future studies should focus on:

  • Structural determination: X-ray crystallography or cryo-EM structures of bdbC1 alone and in complex with substrate proteins would provide critical insights into its mechanism.

  • Molecular dynamics simulations: Computational studies of bdbC1 dynamics during catalysis could reveal transient states important for function.

  • High-throughput substrate screening: Developing methods to identify the full range of bdbC1 substrates in B. anthracis would clarify its biological role.

  • Redox potential determination: Measuring the redox potential of bdbC1 active site cysteines would provide insights into its electron transfer capabilities compared to homologous proteins in other species.

  • In vivo imaging: Developing methods to visualize disulfide bond formation in living cells could revolutionize our understanding of these processes.

How might bdbC1 research contribute to novel antimicrobial strategies?

Potential antimicrobial applications include:

  • Inhibitor development: Design of small molecules that specifically inhibit bdbC1 function could prevent proper folding of essential virulence factors.

  • Attenuated vaccine strains: Engineering B. anthracis strains with modified bdbC1 function could generate attenuated bacteria suitable for vaccine development.

  • Diagnostic tools: Knowledge of bdbC1-dependent protein modifications could lead to novel diagnostic markers for B. anthracis detection.

  • Broad-spectrum approaches: Targeting conserved features of disulfide bond formation pathways across multiple pathogens could yield broad-spectrum antimicrobial strategies.

  • Combination therapies: Inhibitors of disulfide bond formation could sensitize bacteria to existing antibiotics, providing synergistic treatment options for resistant infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.