Recombinant Probable disulfide formation protein C 2 (bdbC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Avoid repeated freezing and thawing. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
bdbC2; pXO1-139; BXA0208; GBAA_pXO1_0208; Probable disulfide formation protein C 2; Disulfide oxidoreductase C 2; Thiol-disulfide oxidoreductase C 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
bdbC2
Target Protein Sequence
MTIIRKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKD SNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTENYLNLFGFISIPMLSFV GFLAIIILLYINQIKRQKNK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Probable disulfide formation protein C 2 (bdbC2)?

Recombinant Probable disulfide formation protein C 2 (bdbC2) is a protein identified in Bacillus anthracis (UniProt ID: Q8KYH8) that likely plays a crucial role in the formation of disulfide bridges essential for protein folding and structural stability. The recombinant form is produced through genetic engineering to express the protein in a host organism different from its native source, allowing for larger quantities to be obtained for research purposes. The protein is available as a recombinant format with defined storage requirements to maintain stability, typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

Why are disulfide bonds important in protein structure and function?

Disulfide bonds are covalent linkages formed between the thiol groups of cysteine residues that play a critical role in maintaining protein structure and biological activity. These bonds contribute significantly to a protein's tertiary structure by stabilizing the folding pattern. The correct disulfide bridge pattern is essential for many proteins' structural integrity and biological function, making it important for researchers to confirm and characterize these connections when studying proteins like bdbC2 . Disruption of these bonds often leads to protein misfolding and loss of biological activity, highlighting their importance in protein biochemistry.

What techniques are used to identify and confirm disulfide bridge patterns in proteins like bdbC2?

Mass spectrometric approaches are the primary methods used for disulfide-bridge identification. These techniques typically involve:

  • Chemical and enzymatic digestion methods to produce peptide fragments containing single disulfide bonds

  • Capillary RP-HPLC coupled to mass spectrometry for separation and analysis of disulfide-linked fragments

  • Identification of fragments based on unique masses and tandem MS fragmentation patterns

The success of these approaches depends on selecting appropriate reagents to cleave the protein at specific residues. For efficient characterization, a mixture of trypsin and chymotrypsin is often effective as it ensures at least one cleavage site between neighboring cysteine residues (trypsin cleaves at K and R, while chymotrypsin targets F, W, and Y) .

How can researchers distinguish between different disulfide bridge isomers?

Proteins containing four cysteines can form three possible disulfide bridge patterns:

  • Globular isomer: Cys1-Cys3 and Cys2-Cys4

  • Ribbon isomer: Cys1-Cys4 and Cys2-Cys3

  • Bead isomer: Cys1-Cys2 and Cys3-Cys4

These isomers can be separated by RP-HPLC due to their different hydrophobicity profiles. Following separation, enzymatic digestion (often with trypsin) and subsequent MS analysis in data-dependent acquisition (DDA) mode can determine their specific disulfide patterns. Research has shown that the least hydrophobic isomer typically corresponds to the globular pattern, while the most hydrophobic tends to be the ribbon isomer . These approaches would be applicable when studying the disulfide pattern of bdbC2.

What strategies can be employed for directed disulfide bridge formation in recombinant proteins like bdbC2?

For controlled formation of specific disulfide bridges, researchers can employ a strategic approach:

  • Plan the formation sequence based on structural importance (e.g., targeting bridges that connect β-sheets to stabilize β-barrel topology first)

  • Use selective protection groups such as acetamidomethyl (Acm) to temporarily block specific cysteine residues

  • Employ native chemical ligation (NCL) when working with complex proteins

  • Allow strategically exposed thiols to oxidize using air oxygen

  • Remove protecting groups using iodine treatment to enable formation of remaining disulfide bonds

This controlled approach allows researchers to guide the formation of the correct disulfide pattern rather than relying on spontaneous oxidation, which can lead to mixed isomers .

How can researchers validate the biological activity of recombinant bdbC2?

Validation of biological activity requires:

  • Confirmation of correct disulfide bond formation using mass spectrometry

  • Functional assays specific to disulfide formation proteins

  • Protein-protein interaction studies to demonstrate engagement with natural substrates

  • Stability assays comparing wild-type and recombinant protein

  • In vitro reconstitution of relevant biological pathways

These validation steps ensure that the recombinant protein maintains its native functionality and can reliably be used in downstream experiments.

What are common challenges when working with disulfide-rich proteins like bdbC2?

Researchers frequently encounter several obstacles when handling disulfide-containing proteins:

  • Spontaneous formation of incorrect disulfide bridges during recombinant expression and purification

  • Heterogeneous mixtures of disulfide isomers that complicate structural and functional studies

  • Reduced stability during purification processes, leading to protein degradation

  • Challenges in mass spectrometric analysis due to complex fragmentation patterns

  • Difficulty in distinguishing between intramolecular and intermolecular disulfide bonds

Overcoming these challenges requires careful optimization of expression systems, purification conditions, and analytical techniques specifically adapted to disulfide-rich proteins.

How can researchers prevent disulfide scrambling during protein analysis?

To prevent disulfide scrambling (rearrangement of disulfide bonds) during analysis:

  • Maintain acidic pH during sample preparation (pH < 3)

  • Alkylate free thiols immediately using iodoacetamide or other alkylating agents

  • Avoid reducing agents unless specifically needed for the analysis

  • Use rapid digestion protocols to minimize exposure time

  • Control temperature during sample handling (typically keeping samples cold)

  • Consider specialized MS-compatible buffers that minimize disulfide exchange

These precautions help preserve the native disulfide arrangement for accurate analytical characterization.

How should MS data be interpreted to confirm disulfide connectivity in bdbC2?

Interpretation of mass spectrometry data for disulfide mapping involves:

  • Identification of peptide fragments corresponding to predicted digestion products

  • Detection of peaks with masses matching the combined mass of two cysteine-containing peptides minus 2 Da per disulfide bond

  • Analysis of MS/MS fragmentation patterns to confirm linkages between specific cysteine residues

  • Comparison of chromatographic retention times with predicted patterns for different isomers

  • Integration of data from complementary digestion approaches

For accurate interpretation, researchers should analyze the "20 most intense peaks" in MS data to identify diagnostic fragments that confirm specific disulfide connectivity patterns .

What statistical approaches are appropriate for analyzing disulfide bridge formation efficiency?

Statistical analysis of disulfide formation should include:

Statistical MethodApplicationData Type
ANOVAComparing efficiency across multiple experimental conditionsPercentage of correct isomer formed
Regression analysisIdentifying factors influencing disulfide formationMultiple experimental variables
Principal Component AnalysisIdentifying patterns in complex MS datasetsSpectral data from multiple experiments
Cluster analysisClassifying different disulfide isomersMS peak distribution patterns
Bootstrap methodsEstimating confidence intervals for formation efficiencyRepeated experimental measurements

These statistical approaches help researchers quantitatively assess the efficiency and specificity of disulfide formation processes.

How can bdbC2 research contribute to protein engineering applications?

Understanding disulfide formation proteins like bdbC2 can advance protein engineering through:

  • Development of enhanced expression systems for disulfide-rich therapeutic proteins

  • Design of novel enzymes with engineered disulfide patterns for increased stability

  • Creation of improved in vitro protein folding methodologies

  • Engineering of oxidoreductase systems with modified substrate specificity

  • Development of synthetic biology tools for controlling protein folding

These applications leverage fundamental knowledge about disulfide formation mechanisms to create practical biotechnology solutions.

What are the implications of bdbC2 research for understanding bacterial pathogenesis?

Since bdbC2 originates from Bacillus anthracis, research on this protein has implications for understanding:

  • The role of disulfide formation in virulence factor maturation

  • Potential vulnerabilities in bacterial protein folding pathways that could be targeted therapeutically

  • Evolution of oxidative protein folding in Gram-positive bacteria

  • Adaptation mechanisms to different redox environments during infection

  • Structure-function relationships in bacterial disulfide-forming enzymes

This knowledge could ultimately contribute to new approaches for combating bacterial infections caused by Bacillus anthracis and related pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.