Recombinant Probable doxorubicin resistance ABC transporter permease protein drrC (drrC)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biological Context

DrrC is critical for conferring resistance to daunorubicin/doxorubicin in S. peucetius. Unlike the ABC transporter system DrrAB (comprising DrrA, an ATPase, and DrrB, a membrane permease), DrrC is a UvrA-like DNA-binding protein that repairs DNA damage caused by anthracycline intercalation . Its expression coincides with antibiotic production and is regulated by daunorubicin itself and transcriptional activators DnrI and DnrN .

Domain Architecture

  • UvrA Homology: DrrC shares 75–77% sequence similarity with E. coli UvrA, featuring ATPase domains and zinc-finger motifs for DNA interaction .

  • Molecular Weight: ~83 kDa (764 amino acids) .

Mechanism of Action

DrrC operates via an ATP-dependent DNA repair mechanism:

  1. DNA Binding: Binds promoter regions of daunorubicin biosynthesis genes in the presence of ATP and daunorubicin .

  2. Drug Removal: Ejects intercalated daunorubicin from DNA, restoring transcriptional activity .

  3. ATP Dependency: ATP hydrolysis facilitates conformational changes for drug displacement .

Key Experimental Findings

ExperimentMethodologyOutcomeSource
Gel Retardation AssayRefolded DrrC + DNA + daunorubicinDNA binding observed only with ATP and daunorubicin
Drug Release AssayBiotinylated DNA + daunorubicin + DrrCHypochromic shift (591 nm → 584 nm) confirmed drug-protein complex formation
Complementation AssayE. coli uvrA mutant + DrrCPartial restoration of daunorubicin resistance

Recombinant Expression and Purification

DrrC has been heterologously expressed in E. coli for functional studies:

  • Expression System: pMAL-c2X vector with N-terminal maltose-binding protein (MBP) tag .

  • Purification: Affinity chromatography followed by refolding to retain DNA-binding activity .

  • Functional Validation: Recombinant MBP-DrrC retained ATPase activity and specificity for daunorubicin-intercalated DNA .

Regulatory and Synergistic Interactions

  • Coordination with DrrAB: While DrrAB mediates ATP-dependent efflux, DrrC provides complementary resistance by repairing DNA damage .

  • Induction Pathway: Daunorubicin upregulates drrC via DnrI/DnrN regulators, synchronizing resistance with antibiotic production .

Comparative Resistance Mechanisms

MechanismDrrAB (ABC Transporter)DrrC (UvrA-like Protein)
FunctionDrug efflux via membrane transportDNA repair and drug ejection
ATP DependencyDirect ATP hydrolysis for transportATP-dependent DNA binding and drug release
LocalizationMembrane-associatedCytoplasmic/nuclear
Genetic RegulationConstitutive expressionInduced by daunorubicin

Biotechnological Implications

  • Drug Discovery: DrrC’s mechanism offers insights into overcoming anthracycline-induced DNA damage in chemotherapy .

  • Synthetic Biology: Engineering drrC in heterologous hosts could enhance antibiotic titers by mitigating self-toxicity .

Unresolved Questions and Future Directions

  • Structural Dynamics: High-resolution structures of DrrC-DNA-drug complexes are needed to elucidate ejection mechanics.

  • Clinical Relevance: Whether DrrC homologs in pathogens contribute to anthracycline resistance remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please specify your preference when placing the order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Target Names
drrC
Target Protein Sequence
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMV VLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVH RASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVT TVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAM GGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH
Uniprot No.

Q&A

What is the primary function of the DrrC protein in Streptomyces peucetius?

DrrC is a 764-amino-acid protein encoded by the drrC gene in Streptomyces peucetius ATCC 29050, a strain that produces daunorubicin (DNR) and doxorubicin. The primary function of DrrC appears to be conferring resistance to daunorubicin. When introduced into Streptomyces lividans, it imparts a DNR resistance phenotype. Notably, the expression of drrC correlates with the timing of DNR production in growth medium, although this expression is not dependent on the presence of DNR itself . Methodologically, this function was determined through gene disruption studies and complementation experiments, where researchers observed that the drrC gene could be disrupted in non-DNR-producing S. peucetius dnrJ mutants but not in wild-type strains, indicating its essential role in DNR-producing organisms .

How does the structure of DrrC relate to its function within the DrrABC complex?

DrrC functions as part of a heterooligomeric ATP-Binding Cassette (ABC) transporter complex composed of DrrA, DrrB, and DrrC. Structurally, DrrC is thought to be analogous to DrrB, as both are predicted to be integral membrane proteins forming the transmembrane porter region of the complex . The general architecture of the DrrABC complex is suggested to be DrrBC-A₂, where a heterodimer of DrrBC forms the transmembrane region, while DrrA contains a classical nucleotide binding domain (NBD) that forms a cytoplasmic dimer providing energy for cargo transport . This structural arrangement places DrrABC in the Type V family of ABC exporters, similar to the Wzm-Wzt family of O-antigen exporters. When designing experiments to study DrrC structure-function relationships, researchers should consider using site-directed mutagenesis targeting the transmembrane domains to assess their roles in substrate recognition and transport .

What experimental approaches are recommended for studying DrrC expression?

To study DrrC expression, researchers should implement a multi-faceted approach combining molecular biology techniques with functional assays. Begin with quantitative RT-PCR to measure mRNA levels under various conditions (different growth phases, presence/absence of daunorubicin, etc.). This should be complemented with Western blotting using anti-DrrC antibodies to quantify protein expression levels . For more advanced analysis, consider developing a reporter gene system where the drrC promoter drives expression of a quantifiable reporter like GFP or luciferase, allowing real-time monitoring of expression.

The timing of expression is critical – based on existing research, DrrC expression correlates with daunorubicin production timing in S. peucetius, so sampling should be conducted across the entire growth curve . To determine regulation mechanisms, construct promoter deletion series to identify regulatory elements, and use electrophoretic mobility shift assays (EMSAs) to identify transcription factors that may bind to the drrC promoter region.

How can researchers distinguish between the functions of DrrC in different bacterial species?

Distinguishing DrrC functions across bacterial species requires comparative genomics coupled with functional validation. Begin by conducting sequence alignments and phylogenetic analyses of DrrC homologs from different species, identifying conserved domains and species-specific variations . For functional validation, perform heterologous expression experiments by expressing DrrC from different species (e.g., S. peucetius vs. M. tuberculosis) in model organisms like E. coli or S. lividans, followed by resistance assays or substrate transport measurements.

Gene knockout/complementation experiments are essential – create DrrC deletion mutants in multiple species and assess phenotypic changes, then complement with DrrC from other species to determine functional conservation . For mechanistic insights, conduct substrate specificity assays using labeled compounds (e.g., radiolabeled daunorubicin for S. peucetius DrrC vs. labeled PDIM for mycobacterial DrrC). Protein localization studies using fluorescent tags or immunofluorescence can reveal differences in subcellular localization that might explain functional divergence.

What are the essential controls required when designing experiments to assess DrrC-mediated resistance?

When designing experiments to assess DrrC-mediated resistance, multiple controls are essential to ensure valid and interpretable results:

  • Genetic controls: Include wild-type strains, drrC deletion mutants, and complemented strains (drrC deletion with reintroduced drrC gene) to demonstrate that observed phenotypes are specifically due to DrrC function .

  • Expression controls: Use qRT-PCR and Western blotting to confirm that DrrC is expressed at the expected levels in experimental strains but absent in negative controls.

  • Drug specificity controls: Test resistance not only to daunorubicin but also to structurally related and unrelated antibiotics to determine specificity of the resistance mechanism .

  • Dose-response curves: Perform efficiency-of-plating experiments across a range of drug concentrations rather than single-dose experiments to fully characterize resistance profiles.

  • Growth phase controls: Since DrrC expression correlates with daunorubicin production timing, assess resistance at different growth phases .

  • Vector controls: For heterologous expression studies, include empty vector controls to account for vector-related effects.

  • Environmental condition controls: Test resistance under various growth conditions (temperature, pH, media composition) as these may affect DrrC function.

How do mutations in the nucleotide binding domains of DrrA affect the function of the entire DrrABC complex?

The function of the DrrABC complex depends on the integrity of the nucleotide binding domains (NBDs) in DrrA, which provide the energy for substrate transport through ATP hydrolysis. To investigate this relationship, researchers should employ site-directed mutagenesis targeting the conserved Walker A and Walker B motifs, as well as the H-loop in DrrA . Mutations in the Walker A motif (e.g., K47A in the consensus GxxGxGKT sequence) would disrupt ATP binding, while mutations in the Walker B motif would affect ATP hydrolysis.

When designing such experiments, researchers should express these mutant variants in appropriate host systems (either native S. peucetius or heterologous systems like M. bovis BCG for PDIM transport studies) and assess:

  • ATP binding capacity using radiolabeled ATP or fluorescent ATP analogs

  • ATP hydrolysis rates via colorimetric phosphate release assays

  • Substrate transport efficiency through either resistance assays (for daunorubicin) or direct measurement of substrate translocation

  • Protein-protein interactions between DrrA and DrrB/C using co-immunoprecipitation or FRET analysis

The unique signature sequence in DrrA (T₁₄₀YSGGMRRR₁₄₈) that differs from the canonical LSGGQ motif in most ABC transporters merits special attention . Targeted mutations in this region would help elucidate whether this unusual sequence contributes to the specialized function of the DrrABC complex in antibiotic resistance or PDIM transport. Consider creating chimeric proteins where this region is swapped with canonical sequences to assess functional consequences.

What experimental approaches can resolve contradictory data regarding DrrC's role in DNA repair versus drug transport?

The dual proposed functions of DrrC—DNA repair (suggested by sequence similarity to UvrA proteins) and drug transport (indicated by resistance phenotypes)—present an intriguing research contradiction. To systematically resolve this, researchers should design experiments that can differentially assess these functions:

  • DNA binding assays: Purify recombinant DrrC and perform electrophoretic mobility shift assays with DNA containing various types of damage (UV-induced lesions, chemical adducts, etc.) to assess DNA binding specificity comparable to UvrA proteins .

  • DNA repair complementation: Express DrrC in UvrA-deficient E. coli and measure survival after UV irradiation, comparing with positive controls (UvrA expression) and negative controls (empty vector) . The published data indicate that DrrC did not complement the UvrA mutation regarding UV or mitomycin sensitivity, suggesting functional divergence despite sequence similarity.

  • Direct transport assays: Develop inside-out membrane vesicles containing the DrrABC complex and directly measure transport of fluorescently labeled daunorubicin or other substrates.

  • Domain swapping experiments: Create chimeric proteins combining domains from UvrA and DrrC to identify which regions confer DNA repair versus transport functions.

  • Structural studies: Perform X-ray crystallography or cryo-EM on DrrC alone and in complex with DrrAB to visualize structural features that might explain the functional duality.

  • Subcellular localization: Use fluorescent protein fusions or immunofluorescence to determine whether DrrC localizes with the membrane transport machinery, DNA repair complexes, or both under different conditions.

How should researchers design experiments to elucidate the coupling mechanism between DrrA's nucleotide binding domains and the DrrB/C porter subunits?

To investigate the energy coupling mechanism between DrrA's nucleotide binding domains (NBDs) and the DrrB/C porter subunits, researchers should employ a multidisciplinary approach focused on protein-protein interactions and conformational changes:

  • Cross-linking studies: Use chemical cross-linkers of varying lengths to identify residues in proximity between DrrA and DrrB/C. Analyze the cross-linked products by mass spectrometry to map interaction interfaces .

  • FRET-based conformational change assays: Introduce fluorescent protein pairs or small-molecule fluorophores at key positions in DrrA and DrrB/C. Monitor FRET efficiency changes upon ATP binding and hydrolysis to detect conformational changes that propagate from the NBDs to the porter domains.

  • Cysteine accessibility studies: Introduce single cysteines at predicted coupling interfaces and measure their accessibility to thiol-reactive compounds under different nucleotide states (ATP, ADP, AMP-PNP).

  • Targeted mutagenesis: Based on homology modeling with other Type V ABC exporters, identify candidate coupling helices and create alanine scanning mutations to disrupt specific interactions . Test these mutants for uncoupling of ATP hydrolysis from substrate transport.

  • Hydrogen-deuterium exchange mass spectrometry: Map regions of conformational flexibility that might be involved in coupling by measuring deuterium incorporation rates under different nucleotide states.

When designing these experiments, researchers should consider the following methodological aspects:

Experimental ApproachKey ControlsData Analysis MethodExpected Outcomes
Cross-linking studiesNon-specific cross-linker controlsMS/MS peptide mappingIdentification of interface residues
FRET assaysDonor-only and acceptor-only controlsFRET efficiency calculationsConformational change dynamics
Cysteine accessibilityCysteine-free background strainsReaction kinetics analysisIdentification of protected residues during transport
MutagenesisConservative vs. disruptive mutationsCorrelation of ATPase activity with transportIdentification of essential coupling residues
H/D exchangeDenatured protein controlsDifferential exchange rate analysisMapping of dynamic protein regions

This systematic approach will help elucidate how ATP binding and hydrolysis energy is transmitted to drive substrate transport through conformational changes in the DrrABC complex .

What is the most appropriate experimental design to investigate differences between DrrC-mediated resistance and DrrAB-mediated resistance?

Investigating the differences between DrrC-mediated and DrrAB-mediated resistance requires a well-controlled experimental design that can distinguish between these potentially distinct mechanisms. A comprehensive approach should include:

  • Genetic dissection: Construct single (ΔdrrA, ΔdrrB, ΔdrrC), double (ΔdrrAB, ΔdrrAC, ΔdrrBC), and triple (ΔdrrABC) deletion mutants in S. peucetius. Complement these with various combinations of genes to observe resistance patterns .

  • Comparative resistance profiling: Subject each mutant and complemented strain to efficiency-of-plating experiments against daunorubicin and structurally related antibiotics across a concentration gradient. Analyze data using both IC50 values and area-under-the-curve approaches to capture subtle differences in resistance profiles .

  • Transport kinetics: Develop an in vitro transport system using inverted membrane vesicles prepared from each strain. Measure transport rates of fluorescently labeled substrates, determining Vmax and Km values to identify differences in transport efficiency and substrate affinity.

  • Energy requirements: Compare ATP consumption between DrrAB and DrrC systems during transport using luciferase-based ATP monitoring. Determine the coupling efficiency (substrate transported per ATP hydrolyzed) for each system.

  • Substrate specificity: Test a panel of structurally diverse compounds to determine if DrrC and DrrAB have overlapping or distinct substrate preferences.

The experimental design should follow a factorial approach, systematically varying gene combinations and drug types/concentrations. The table below outlines a possible experimental matrix:

StrainDaunorubicinDoxorubicinStructural Analog 1Structural Analog 2Unrelated Antibiotic
Wild-typeDose seriesDose seriesDose seriesDose seriesDose series
ΔdrrADose seriesDose seriesDose seriesDose seriesDose series
ΔdrrBDose seriesDose seriesDose seriesDose seriesDose series
ΔdrrCDose seriesDose seriesDose seriesDose seriesDose series
ΔdrrABDose seriesDose seriesDose seriesDose seriesDose series
ΔdrrBCDose seriesDose seriesDose seriesDose seriesDose series
ΔdrrACDose seriesDose seriesDose seriesDose seriesDose series
ΔdrrABCDose seriesDose seriesDose seriesDose seriesDose series

This approach will provide robust data to determine whether DrrC operates through a mechanism "possibly different from the mechanism of DNR resistance governed by the S. peucetius drrAB genes" .

How can researchers accurately analyze the contribution of DrrC to PDIM transport in mycobacteria while controlling for potential compensatory mechanisms?

Analyzing DrrC's specific contribution to PDIM transport in mycobacteria requires careful experimental design to control for compensatory mechanisms that might mask phenotypic effects. Researchers should implement the following methodological approach:

  • Conditional expression systems: Rather than relying solely on knockout studies, develop conditional expression systems (tetracycline-inducible or similar) for drrC to observe immediate effects upon depletion before compensatory mechanisms can develop .

  • Time-course analysis: Following drrC depletion, measure PDIM transport at multiple time points (early, intermediate, late) to distinguish direct effects from compensatory adaptations. Use both lipid analysis (thin layer chromatography, mass spectrometry) and cell envelope fractionation to quantify PDIM distribution.

  • Transcriptomic profiling: Perform RNA-seq analysis comparing wild-type, drrC knockout, and complemented strains to identify upregulated genes that might represent compensatory mechanisms . Focus particularly on other transporters and lipid biosynthesis genes.

  • Proteomic analysis: Use SILAC or TMT-based quantitative proteomics to identify proteins with altered abundance in response to drrC deletion, focusing on membrane proteins.

  • Double knockout strategies: Create double knockouts targeting drrC together with potential compensatory transporters (based on transcriptomic/proteomic data) to prevent adaptation.

  • In vitro reconstitution: Purify components of the DrrABC complex and reconstitute them in liposomes with defined lipid composition. Compare PDIM transport efficiency with and without DrrC to establish its direct contribution.

For data analysis, researchers should employ multivariate approaches such as principal component analysis to distinguish direct from compensatory effects in complex datasets. The experimental design should include technical replicates (n≥3) and biological replicates (n≥3) to ensure statistical validity, with appropriate normalization controls for each assay type .

What are the optimal conditions for expressing and purifying recombinant DrrC protein for structural studies?

Expressing and purifying recombinant DrrC for structural studies presents significant challenges due to its nature as an integral membrane protein. Based on its characteristics, researchers should consider the following methodological approach:

  • Expression system selection: For initial trials, use E. coli strains specifically designed for membrane protein expression (C41/C43(DE3) or Lemo21(DE3)) . For higher yields or if E. coli expression fails, consider Pichia pastoris or insect cell systems, which often provide better folding environments for complex membrane proteins.

  • Construct optimization:

    • Include a C-terminal His10 tag rather than the standard His6 to improve purification efficiency

    • Consider fusion partners like GFP (to monitor expression/folding) or MBP (to enhance solubility)

    • Test both full-length constructs and constructs with flexible termini removed (based on bioinformatic predictions)

  • Expression conditions:

    • Use low induction temperatures (16-20°C) to slow protein production and improve folding

    • Test various inducers (IPTG at 0.1-0.5 mM, auto-induction media)

    • Supplement media with specific lipids that might stabilize the protein

  • Solubilization and purification:

    • Screen detergents systematically: start with mild detergents (DDM, LMNG) and detergent mixtures

    • Consider native nanodiscs or SMALPs (styrene-maleic acid lipid particles) for detergent-free extraction

    • Purify using tandem affinity steps (e.g., IMAC followed by size exclusion chromatography)

The table below summarizes optimal conditions based on typical membrane protein purification strategies:

ParameterPrimary ConditionAlternativesMonitoring Method
Expression hostE. coli C43(DE3)P. pastoris, Sf9 cellsWestern blot
Growth temperature18°C post-induction16°C, 20°CGrowth curves
Induction0.2 mM IPTG for 16-20hAuto-induction, 0.5 mM IPTGSDS-PAGE
Solubilization1% DDM, 4°C, 2h1% LMNG, SMA copolymerSolubilization efficiency
Purification buffers20 mM Tris pH 8.0, 150 mM NaCl, 0.05% DDMHEPES buffer systemsProtein stability
Purification methodIMAC → SECIMAC → Ion exchange → SECPurity by SDS-PAGE
Stability additives10% glycerol, cholesterol hemisuccinateE. coli lipid extractThermal shift assays

For structural studies, assess protein quality using negative-stain EM before proceeding to cryo-EM or crystallization trials. Consider co-expression with DrrB and/or DrrA to improve stability and capture physiologically relevant conformations .

How can researchers overcome challenges in distinguishing between direct and indirect effects when studying DrrC's role in antibiotic resistance?

Distinguishing direct from indirect effects in DrrC-mediated antibiotic resistance requires multiple complementary approaches that isolate specific mechanisms while controlling for system-wide adaptations:

  • Direct binding assays: Develop fluorescence-based or radiolabeled substrate binding assays using purified DrrC or membrane vesicles containing DrrC to establish direct interaction with antibiotics. Include competitive binding assays with structural analogs to confirm specificity .

  • Rapid induction/depletion systems: Implement CRISPRi or degron-based systems for rapid depletion of DrrC, measuring resistance phenotypes before compensatory mechanisms can develop. Compare with steady-state knockouts to identify differences suggestive of adaptation.

  • Single-cell analysis: Use microfluidic systems coupled with time-lapse microscopy and fluorescent antibiotic analogs to observe real-time drug accumulation in individual cells with varying DrrC levels, allowing direct correlation between DrrC expression and drug efflux.

  • In vitro reconstitution: Reconstitute purified DrrC (alone or with DrrAB) into proteoliposomes and directly measure transport of fluorescent antibiotics. This isolated system eliminates cellular complexity and allows definitive attribution of transport activity to DrrC .

  • Genetic interaction mapping: Perform synthetic genetic array analysis with drrC deletion to identify genes whose deletion exacerbates or suppresses the drrC phenotype, revealing functional pathways.

  • Metabolomic profiling: Compare metabolite profiles of wild-type and drrC mutant strains under antibiotic stress to identify metabolic adaptations that might contribute to resistance indirectly.

When analyzing data from these experiments, researchers should apply causal inference statistical methods (e.g., mediation analysis) to distinguish direct effects from indirect ones. The experimental design should include appropriate time-resolved measurements to capture immediate versus adaptive responses, and multiple drug concentrations to establish dose-response relationships that can differentiate between different resistance mechanisms .

What statistical approaches are most appropriate for analyzing variable expression of DrrC across different experimental conditions?

When analyzing variable DrrC expression across different experimental conditions, researchers should employ a comprehensive statistical approach that addresses biological variability, technical noise, and complex experimental designs:

The table below outlines recommended statistical approaches for different data types:

Data TypeRecommended Primary AnalysisAlternative ApproachesPost-hoc Testing
qRT-PCR2^-ΔΔCt with mixed ANOVAPfaffl method, MCMC.qpcrTukey's HSD, Dunnett's test
Western blotNormalized band intensity with robust ANOVANonparametric testsBonferroni-corrected comparisons
ProteomicsLinear models for microarray data (limma)SAM, PLGEMFDR-controlled comparisons
RNA-seqDESeq2 or edgeRlimma-voom, sleuthLikelihood ratio tests

How should researchers design and interpret experiments to understand the evolutionary relationship between DrrC's role in DNA repair and antibiotic resistance?

Understanding the evolutionary relationship between DrrC's potential roles in DNA repair and antibiotic resistance requires a comprehensive approach combining comparative genomics, functional analysis, and evolutionary reconstruction:

  • Phylogenomic analysis:

    • Collect DrrC homologs across diverse bacterial phyla, with special attention to both antibiotic-producing actinomycetes and non-producers

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Perform ancestral sequence reconstruction to infer evolutionary transitions

    • Map functional domains and motifs shared with UvrA DNA repair proteins versus transport-specific domains

  • Functional domain analysis:

    • Conduct domain-swapping experiments between DrrC and bona fide UvrA proteins

    • Use targeted mutagenesis to modify conserved residues unique to either DNA repair or transport functions

    • Perform co-evolution analysis to identify residues that have evolved in concert, suggesting functional coupling

  • Experimental confirmation:

    • Test ancestrally reconstructed sequences for both DNA repair and transport activities

    • Perform comparative assays measuring both DNA repair capacity (UV resistance) and antibiotic resistance across evolutionary distant DrrC homologs

    • Use heterologous expression in both DNA repair-deficient and transport-deficient backgrounds

  • Structural biology approach:

    • Determine structures of DrrC from different evolutionary points

    • Compare binding sites and conformational changes upon interaction with DNA versus antibiotics

    • Use molecular dynamics simulations to study evolutionary shifts in protein flexibility and substrate interactions

For experimental design, researchers should follow a nested comparative approach, testing multiple species across the phylogenetic tree rather than focusing on a single model organism. This allows for more robust evolutionary inference. The statistical analysis should incorporate phylogenetic correction methods (such as phylogenetic independent contrasts or phylogenetic generalized least squares) to account for shared evolutionary history when comparing functional traits .

What reference genes and controls are essential when quantifying DrrC expression using qRT-PCR in different bacterial species?

When quantifying DrrC expression using qRT-PCR across different bacterial species, researchers must carefully select appropriate reference genes and controls to ensure accurate normalization and valid cross-species comparisons:

  • Reference gene selection:

    • For Streptomyces species: Use a combination of hrdB (principal sigma factor), rpoB (RNA polymerase β subunit), and gyrB (DNA gyrase subunit B)

    • For Mycobacterium species: Consider sigA (sigma factor), 16S rRNA (with caution due to high abundance), and rrs (ribosomal protein)

    • For E. coli expression systems: recA, gyrA, and ihfB have shown stability across various conditions

    • Always validate reference gene stability using algorithms like geNorm, NormFinder, or BestKeeper before proceeding with experiments

  • Essential experimental controls:

    • No-template controls (NTCs) for each primer set to detect contamination

    • No-reverse transcriptase controls (-RT) to assess genomic DNA contamination

    • Positive controls using constitutively expressed genes specific to each species

    • Standard curves with purified PCR products or plasmids containing target sequences to validate amplification efficiency

    • Melt curve analysis to confirm amplicon specificity

  • Cross-species comparison controls:

    • Include calibrator samples common to all experiments when comparing across species

    • Develop normalization factors based on total RNA or genomic DNA content

    • Consider spike-in controls with synthetic RNA standards

    • Account for differences in genome size and gene copy number between species

  • Sampling and preparation controls:

    • Harvest cells at standardized growth phases across all species

    • Use consistent RNA extraction methods validated for each species

    • Assess RNA integrity using bioanalyzer or gel electrophoresis

    • Standardize cDNA synthesis protocols with consistent RNA input

The following table summarizes recommended reference genes and validation parameters:

Bacterial SpeciesPrimary Reference GenesSecondary Reference GenesValidation MethodCritical Quality Controls
S. peucetiushrdB, rpsLgyrB, rpoBgeNormRNA integrity number >7.0
M. tuberculosis/bovissigA, 16S rRNArrs, ftsZNormFinder-RT controls <35 Ct
E. colirecA, gyrAihfB, cysGBestKeeperEfficiency between 90-110%
Multiple species comparisonSpecies-specific sets + universal targets (rpoB)Synthetic spike-insCombined stability rankingStandard curves for all targets

When analyzing qRT-PCR data across species, researchers should apply inter-run calibration methods to minimize batch effects and consider using advanced normalization approaches such as NORMA-Gene or global pattern recognition when traditional reference genes show variability .

What emerging technologies are most promising for elucidating the detailed mechanism of DrrC-mediated transport?

Several cutting-edge technologies show exceptional promise for uncovering the detailed mechanism of DrrC-mediated transport, advancing our understanding beyond current limitations:

  • Cryo-electron microscopy (Cryo-EM): Recent advances in single-particle cryo-EM now enable near-atomic resolution of membrane proteins without crystallization. For DrrC research, this allows visualization of the protein in multiple conformational states during the transport cycle . Time-resolved cryo-EM with millisecond freezing can potentially capture transient intermediates of the transport process.

  • Single-molecule FRET (smFRET): By strategically placing fluorophore pairs on DrrC and its partners, researchers can monitor real-time conformational changes during substrate binding and transport at the single-molecule level. This provides insights into the dynamics and heterogeneity of the transport mechanism that ensemble methods cannot reveal.

  • Native mass spectrometry: This technique can determine the stoichiometry and stability of the DrrABC complex and identify lipids or other molecules that co-purify with the complex, providing insights into the native environment required for function .

  • In-cell NMR spectroscopy: Emerging capabilities to perform NMR on membrane proteins within living cells could enable studies of DrrC dynamics in its native membrane environment under physiological conditions.

  • Nanobody/synthetic antibody technologies: Developing conformationally selective nanobodies can help stabilize specific states of the transport cycle for structural studies or modulate DrrC function in vivo.

  • Artificial intelligence approaches: AlphaFold2 and similar systems can predict structural features of DrrC and its interactions, guiding experimental design. Machine learning analysis of large datasets from omics experiments can identify previously unrecognized patterns in DrrC function.

  • Genome-wide CRISPR screens: Systematic identification of genes that influence DrrC function can reveal unexpected interactions and regulatory networks.

When implementing these technologies, researchers should adopt an integrative approach, combining structural information with functional assays and computational modeling to develop a comprehensive understanding of the transport mechanism .

How might detailed understanding of DrrC contribute to developing novel strategies for combating antibiotic resistance?

The detailed understanding of DrrC could lead to innovative strategies for combating antibiotic resistance through multiple translational approaches:

  • Inhibitor development: With detailed structural information about DrrC and its interaction with antibiotics like daunorubicin, researchers could design specific inhibitors that block the efflux function . These inhibitors would act as resistance-breakers, restoring antibiotic sensitivity in resistant organisms. Structure-based drug design approaches, including fragment-based screening and computational docking, could identify molecules that bind to critical regions of DrrC.

  • Antibiotic modification: Understanding how DrrC recognizes and transports specific antibiotics provides a foundation for designing modified antibiotics that retain antimicrobial activity but evade efflux. This "molecular disguise" approach has succeeded with other antibiotic classes and could be applied to anthracyclines based on DrrC-substrate interaction data .

  • Diagnostic applications: Knowledge of DrrC's sequence and expression patterns could lead to diagnostic tools that identify resistance mechanisms before treatment failure. PCR-based or CRISPR-Cas12/13-based detection systems could rapidly identify drrC-mediated resistance in clinical isolates.

  • Heterologous expression systems: Engineered bacteria expressing modified DrrC proteins could serve as production platforms for novel anthracycline derivatives, allowing controlled biosynthesis and export of compounds that would otherwise be toxic to the producing organism.

  • Mycobacterial applications: Understanding DrrC's role in PDIM transport in mycobacteria provides targets for disrupting virulence lipid export in M. tuberculosis, potentially attenuating pathogenicity without directly targeting essential functions (which might reduce selection for resistance) .

For experimental design in this translational area, researchers should prioritize:

  • High-throughput screening methodologies for inhibitor discovery

  • Medicinal chemistry optimization of hit compounds

  • Validation in clinically relevant models

  • Combination studies with existing antibiotics to assess synergy

  • Resistance development monitoring to assess the barrier to resistance for new approaches

This multifaceted strategy leverages fundamental understanding of DrrC to address the practical challenge of antibiotic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.