Recombinant Probable G-protein coupled receptor C02B8.5 (C02B8.5)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

C02B8.5 is classified as a "probable" GPCR, indicating its structural homology to canonical G-protein coupled receptors despite incomplete functional characterization. GPCRs are seven-transmembrane (7TM) proteins that transduce extracellular signals via intracellular G-proteins or β-arrestins . Orphan receptors like C02B8.5 lack identified endogenous ligands, complicating their study .

Recombinant Production Challenges

Producing recombinant GPCRs like C02B8.5 involves overcoming expression and stability hurdles common to membrane proteins:

  • Expression Systems: Common platforms include mammalian (HEK293, CHO), insect (Sf9), and yeast cells. Mammalian systems preserve post-translational modifications (e.g., glycosylation, palmitoylation) critical for folding and function .

  • Solubilization: Detergents (e.g., DDM) or styrene maleic acid (SMA) copolymers stabilize GPCRs during extraction .

  • Yield vs. Functionality: High expression levels (e.g., in yeast) do not guarantee functional receptors; ligand-binding assays (radioligand/NanoBRET) are essential for validation .

Table 1: Recombinant GPCR Production Systems

SystemAdvantagesDisadvantages
Mammalian CellsNative PTMs, functional fidelity Low yield, high cost
Insect CellsModerate yield, scalable Limited PTMs
YeastHigh yield, cost-effective Misfolding risks, no complex PTMs

Functional and Pharmacological Implications

While C02B8.5’s exact role is unknown, GPCR heteromerization (e.g., adenosine A2A-dopamine D2 dimers) suggests potential cross-talk with neurotransmitter systems . Mutagenesis studies on analogous receptors highlight residues critical for ligand binding or signaling :

  • Mutation Analysis: GPCRDB catalogs >7,700 GPCR mutations, including effects on ligand affinity and constitutive activity .

  • Ligand-Binding Data: Orphan receptors often bind synthetic ligands identified via high-throughput screening .

Table 3: Steps for C02B8.5 Functional Characterization

StepMethodologyPurpose
Codon optimizationMammalian codon bias adaptation Enhance expression
Stable cell line generationLentiviral transduction Reproducible receptor production
β-arrestin recruitment assayBRET/FRET Assess constitutive activity

Research Gaps and Future Directions

  • Ligand Identification: Screening against compound libraries (e.g., ChEMBL) .

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve active/inactive states .

  • Disease Relevance: Linkage to pathologies via knockout models or GWAS data .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please specify them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
frpr-1; C02B8.5; Probable G-protein coupled receptor frpr-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
frpr-1
Target Protein Sequence
MSVFITVASAFDCLVLVAASEKFKSKFCSVNTSILVGNFNDFKNVIVCLKIIVKIFLLGI FYNSPHMYEIYVIDCWSTMYNTASKDVCPTALRSNVDYVRIYYVYMYTIVMAVGPVLLLI VINTAIVISMRRSSSPNSESDIITLVLVVCLFISCNVLPLTVNFLELLFGIINSYLIDLS NLMVVVNSSCNFLIYYTFGSNFRRTLRYYVRAALNRRAPAQNAANNRTPPRVKLCLPPTE CCNRRMTKSSSQPCLSYDSSMMAESLDEAMFTFPNLASTDQATLFQPPNGFGAAGGGSVR SEDGQKPDYESVDGDVPMASMAGPSVMTTKVSIAAFGAGTPLDQSVNGECPTYACMSCKM SLLNGFLANPNIGAADNATLTAQRNALAIKLGSTTGSCDQHSRKKRFSEEYSTVNKYKIK KVRLLDNFNKNMVAHLIPTSLQRLTKRFVLMNTTPDTDSLNNDIDDNTIDQDTSTDSFTS TDPKNRPVLGVVTSLGCQYRRGEALQTNSEWCGLCNLCWQWRKLPADYYPNYLNEVNCDH NDDGCLSGFGECKPIMRTINVMRQNGDDWVKESIDTTTGCECQVEIGSSLHGLVVK
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C02B8.5

STRING: 6239.C02B8.5

UniGene: Cel.36832

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the C02B8.5/frpr-1 receptor and what organism does it originate from?

The C02B8.5 (also known as frpr-1) is a G-protein coupled receptor (GPCR) belonging to the FMRFamide-like peptide receptor family found in Caenorhabditis elegans. It functions as a seven-transmembrane receptor involved in neuropeptide signaling pathways. This receptor is classified among the 149 putative neuropeptide receptors identified in C. elegans that participate in various physiological processes .

How does C02B8.5/frpr-1 relate to other FMRFamide-like peptide receptors in C. elegans?

The C02B8.5/frpr-1 receptor belongs to the same family as other FMRFamide-like peptide receptors such as FRPR-8, which has been demonstrated to respond to FLP-12 neuropeptide and regulate locomotor activities in C. elegans. While FRPR-8 has been shown to mediate stomatal oscillation and omega turns, the specific functions of C02B8.5/frpr-1 require further characterization. The relationship between these receptors provides important contextual understanding for researchers investigating neuropeptide signaling in nematodes .

What expression systems are commonly used for producing recombinant C02B8.5?

Recombinant C02B8.5/frpr-1 can be produced using multiple expression systems, each offering distinct advantages for different experimental applications:

Expression SystemAdvantagesTypical Applications
E. coliHigh yield, cost-effective, rapid productionStructural studies, antibody generation
YeastPost-translational modifications, higher-order foldingFunctional assays requiring glycosylation
BaculovirusInsect cell expression, complex folding patternsSignaling studies, ligand binding assays
Mammalian cellsNative-like post-translational modificationsFunctional characterization, drug screening

Researchers should select the expression system based on their specific experimental requirements regarding protein folding, post-translational modifications, and downstream applications .

What are the optimal methods for characterizing G-protein coupling specificity for GPCRs like C02B8.5?

Characterizing G-protein coupling specificity requires a multi-faceted approach combining structural and biophysical methods. Based on analogous studies with β2-adrenergic receptor, researchers should consider:

  • Developing biased agonists that selectively activate specific G-protein pathways

  • Employing cryo-electron microscopy to capture receptor-G protein complexes

  • Utilizing bioluminescence resonance energy transfer (BRET) assays to measure receptor-G protein interactions in real-time

  • Performing site-directed mutagenesis at intracellular loop 2 (ICL2) and transmembrane helix 6 (TM6), as these regions have been identified as critical determinants of G-protein selectivity

Evidence from similar GPCRs indicates that distinct conformations at ICL2 and TM6 are required for coupling different G protein subtypes, which would be valuable experimental targets when investigating C02B8.5/frpr-1 specificity .

How should researchers design experiments to investigate the functional role of C02B8.5/frpr-1 in C. elegans?

A comprehensive experimental design should employ a randomized block design approach rather than a completely randomized design to account for potential confounding variables. The experimental protocol should include:

  • Generation of deletion mutants using CRISPR/Cas9 genome editing

  • Rescue experiments with wild-type cDNA under native promoter control

  • Cell-specific RNAi knockdown to determine tissue-specific functions

  • Behavioral assays to assess phenotypic consequences (locomotion, feeding, etc.)

  • Calcium imaging to evaluate neuronal activation patterns

This design isolates the causal relationship between receptor function and phenotypic outcomes while controlling for variability within treatment conditions, making it easier to detect differences in treatment outcomes .

What in vitro assays can reliably measure C02B8.5/frpr-1 activation by potential ligands?

Based on successful approaches with related receptors like FRPR-8, researchers should consider implementing the following assays:

  • Two-electrode voltage-clamp experiments in Xenopus oocytes: Microinject receptor cRNA into oocytes and measure electrophysiological responses to candidate ligands at varying concentrations (1-1000 nM) to determine EC50 values.

  • Calcium mobilization assays in mammalian cells: Generate stable cell lines expressing the receptor along with a promiscuous G-protein alpha subunit (e.g., Gα16) and use calcium-sensitive dyes like Fluo-4 to detect intracellular calcium elevation upon ligand binding.

  • GTPγS binding assays: Measure G-protein activation directly by quantifying the exchange of GDP for non-hydrolyzable GTPγS upon receptor activation.

These methodologies have proven effective for characterizing related receptors from the same organism and provide complementary data on receptor pharmacology .

How can researchers identify the natural ligand(s) for C02B8.5/frpr-1 in C. elegans?

Identifying natural ligands requires a systematic approach combining in silico, in vitro, and in vivo methods:

  • Bioinformatic prediction: Analyze C. elegans peptidome for FMRFamide-like sequences with structural similarity to known FRPR ligands.

  • Reverse pharmacology screening: Test a library of synthetic C. elegans neuropeptides using calcium mobilization assays in heterologous expression systems.

  • Co-expression analysis: Identify neuropeptide genes whose expression patterns overlap with C02B8.5/frpr-1 expression domains.

  • Double mutant analysis: Generate and characterize double mutants of C02B8.5/frpr-1 and candidate ligand genes to test for non-additive phenotypes that suggest receptor-ligand relationships.

  • In vivo calcium imaging: Express calcium indicators in C02B8.5/frpr-1-expressing neurons and monitor responses to application of candidate peptides.

This comprehensive approach has successfully identified FLP-12 as a ligand for FRPR-8 and could be adapted for C02B8.5/frpr-1 .

What strategies should be employed to investigate the signaling pathways downstream of C02B8.5/frpr-1?

Elucidating downstream signaling requires a multi-level investigation approach:

  • G-protein subtype identification: Use RNAi knockdown of different G-protein subunits to determine which are essential for receptor signaling.

  • Second messenger analysis: Measure changes in cAMP, cGMP, IP3, or calcium levels following receptor activation using specific biosensors.

  • Phosphoproteomics: Perform comparative phosphoproteomic analysis of wild-type vs. receptor mutant animals to identify differentially phosphorylated proteins.

  • Genetic interaction screens: Cross receptor mutants with mutants in candidate signaling molecules (e.g., cGMP-gated channels like TAX-2/TAX-4) to identify genetic interactions.

Research on CO2 avoidance behavior in C. elegans has demonstrated the importance of cGMP signaling pathways involving TAX-2/TAX-4 channels, which could serve as a model for investigating signaling downstream of C02B8.5/frpr-1 .

What are the most effective approaches for investigating the structural basis of C02B8.5/frpr-1 ligand binding and G-protein coupling?

Structural characterization of C02B8.5/frpr-1 requires advanced techniques adapted for membrane proteins:

  • Cryo-electron microscopy (cryo-EM): This method has revolutionized GPCR structural biology by enabling visualization of receptors in complex with G proteins without the need for crystallization. Researchers should purify the receptor-G protein complex in the presence of stabilizing nanobodies.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can reveal conformational changes and dynamics upon ligand binding and G-protein coupling by measuring the exchange rates of backbone amide hydrogens.

  • Site-directed mutagenesis coupled with functional assays: Systematic mutation of residues in predicted ligand-binding pockets or G-protein interaction interfaces can identify critical determinants of specificity.

  • Molecular dynamics simulations: Computational approaches can predict conformational changes and energetics of receptor-ligand and receptor-G protein interactions.

Recent structural studies on the β2-adrenergic receptor have highlighted the importance of distinct conformations at ICL2 and TM6 for coupling different G protein subtypes, providing a valuable framework for similar investigations of C02B8.5/frpr-1 .

How should researchers address the challenges of purifying sufficient quantities of functionally active C02B8.5/frpr-1 for structural studies?

Obtaining purified, functional receptor requires optimization at multiple steps:

  • Expression system selection: For structural studies, insect cell or mammalian expression systems typically yield properly folded GPCRs in sufficient quantities.

  • Construct design: Incorporate stability-enhancing modifications such as:

    • Truncation of flexible N- and C-terminal regions

    • Introduction of thermostabilizing mutations identified through alanine scanning

    • Fusion to crystallization chaperones like T4 lysozyme or BRIL

  • Detergent screening: Test a panel of detergents or nanodiscs to identify conditions that preserve receptor function during extraction and purification.

  • Ligand stabilization: Purify the receptor in the presence of high-affinity ligands to stabilize a specific conformation.

  • Quality control: Implement ligand binding assays and thermal stability assessments to verify that purified receptor retains its functional properties.

For biotinylated variants, the AviTag-BirA technology can be particularly useful, as it enables specific biotinylation of the receptor for immobilization or detection purposes .

What behavioral assays can effectively evaluate the physiological role of C02B8.5/frpr-1 in C. elegans?

Based on studies of related neuropeptide receptors in C. elegans, researchers should employ a battery of quantifiable behavioral assays:

  • Locomotion analysis: Track parameters such as speed, body bends, head lifts, stomatal oscillation, omega turns, and reversals using automated tracking systems.

  • Sensory response assays: Measure chemotaxis, thermotaxis, and avoidance behaviors to various stimuli, particularly those that might involve neuropeptide signaling.

  • Foraging behavior assessment: Quantify dwelling vs. roaming states, local search behaviors, and food-leaving behaviors.

  • Stress response evaluation: Examine behavioral and physiological responses to environmental stressors like hypoxia, osmotic stress, or pathogen exposure.

  • Life history trait analysis: Measure developmental timing, lifespan, and reproductive parameters to assess broader physiological impacts.

Studies on the related receptor FRPR-8 have successfully used metrics such as stomatal oscillation and omega turns to quantify phenotypic effects, providing useful methodological precedents .

How can researchers determine the neural circuits in which C02B8.5/frpr-1 functions?

Elucidating the neural circuitry requires complementary cellular and functional approaches:

  • Expression pattern analysis: Generate transgenic animals expressing fluorescent reporter genes under the control of the C02B8.5/frpr-1 promoter to identify expressing cells.

  • Cell-specific rescue experiments: Express wild-type receptor cDNA under cell-specific promoters in receptor mutants to determine where receptor function is required for normal behavior.

  • Cell-specific RNAi knockdown: Use cell-specific promoters to drive expression of double-stranded RNA targeting the receptor in specific neurons.

  • Optogenetic and chemogenetic manipulation: Activate or inhibit receptor-expressing neurons using tools like Channelrhodopsin or HisCl channels to determine their role in behavior.

  • Calcium imaging: Express genetically encoded calcium indicators like GCaMP in receptor-expressing neurons to monitor their activity during behaviors of interest.

Research on related neuropeptide systems has identified specific neurons like the BAG sensory neurons as critical components of sensory circuits, providing valuable methodological frameworks .

What statistical approaches are most appropriate for analyzing data from C02B8.5/frpr-1 functional studies?

Proper statistical analysis is crucial for robust interpretation of experimental data:

  • For behavioral experiments: Implement a randomized block design rather than a completely randomized design to control for potential confounding variables. This approach reduces variability within treatment conditions, making it easier to detect significant differences.

  • For dose-response assays: Fit data to appropriate models (e.g., four-parameter logistic regression) to determine EC50 values and efficacy parameters.

  • For genetic interaction studies: Apply factorial ANOVA to assess main effects and interactions between genetic manipulations.

  • For electrophysiological recordings: Use repeated measures ANOVA or mixed-effects models to account for multiple measurements from the same cells or animals.

  • For imaging data: Implement appropriate spatiotemporal analysis methods to extract meaningful signals from noisy calcium imaging or other microscopy data.

These statistical approaches ensure that experimental results can be interpreted with appropriate confidence and that subtle phenotypic effects can be detected reliably .

How should researchers interpret seemingly contradictory results between in vitro and in vivo studies of C02B8.5/frpr-1?

Resolving apparent contradictions requires systematic investigation of potential explanations:

  • Context-dependent signaling: GPCRs often exhibit different signaling properties in different cellular contexts due to variations in the expression of G proteins, arrestins, and other signaling components.

  • Receptor heteromerization: Formation of heteromeric complexes with other GPCRs can alter signaling properties in vivo but may not be recapitulated in simplified in vitro systems.

  • Post-translational modifications: Differences in receptor phosphorylation, glycosylation, or other modifications between expression systems and native contexts can affect function.

  • Accessory proteins: Native cellular environments may contain GPCR-interacting proteins that modulate receptor function but are absent in heterologous systems.

  • Methodological limitations: Consider differences in sensitivity and specificity between in vitro assays and in vivo readouts.

Systematic investigation of these factors, perhaps using chimeric approaches that gradually increase system complexity, can help reconcile apparently contradictory results and provide deeper insights into receptor biology .

How might C02B8.5/frpr-1 be relevant to understanding neuropeptide signaling in other organisms including humans?

Comparative analysis of neuropeptide signaling has significant translational potential:

  • Evolutionary conservation: Many neuropeptide systems show remarkable conservation across phyla, suggesting that mechanisms elucidated in C. elegans may inform understanding of homologous systems in mammals.

  • Drug discovery applications: Understanding the structural basis of neuropeptide-receptor interactions can inform the design of modulators for human GPCRs involved in neurological and psychiatric disorders.

  • Signaling pathway insights: Elucidation of downstream effectors in C. elegans can reveal novel components of evolutionarily conserved signaling cascades.

  • Neural circuit principles: Principles of circuit organization and modulation by neuropeptides may translate to more complex nervous systems.

Studies on G protein coupling specificity in model GPCRs like the β2-adrenergic receptor have already demonstrated the value of detailed mechanistic understanding for therapeutic development, suggesting similar potential for insights derived from C02B8.5/frpr-1 .

What new technologies might advance our understanding of C02B8.5/frpr-1 function in the near future?

Emerging technologies offer exciting opportunities for deeper characterization:

  • Cryo-electron tomography: This technique could potentially visualize receptor organization and signaling complexes within native membrane environments.

  • Single-molecule imaging: Methods for tracking individual receptor molecules in living cells could reveal dynamics of receptor activation, diffusion, and clustering.

  • Genetically encoded biosensors: Next-generation sensors for G protein activation, second messengers, and downstream signaling events will enable real-time visualization of signaling cascades in vivo.

  • Spatial transcriptomics and proteomics: These approaches can map the expression and modification states of receptors and their signaling partners with unprecedented spatial resolution.

  • Advanced genome editing: Continued refinement of CRISPR-based methods will enable more precise manipulation of receptor genes, including introduction of specific mutations and tagging at endogenous loci.

These technological advances will help address current knowledge gaps and provide more integrated understanding of C02B8.5/frpr-1 function across molecular, cellular, and organismal scales.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.