Recombinant Probable G-protein coupled receptor C06G4.5 (C06G4.5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability for long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol includes 50% glycerol, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us during your order and we will prioritize its inclusion in the production process.
Synonyms
C06G4.5; Probable G-protein coupled receptor C06G4.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C06G4.5
Target Protein Sequence
MSTNLVDYVDDSYLNQSMNSENGLDSVTQIMYDMKKYNIVNDVLPPPNHEDLHVVIMAVS YLLLFLLGTCGNVAVLTTIYHVIRSSRATLDNTLIYVIVLSCVDFGVCLSLPITVIDQIL GFWMFGKIPCKLHAVFENFGKILSALILTAMSFDRYAGVCHPQRKRLRSRNFAITILLVL AVYAFITLCPLLWSFTAREIILYAKETAPGMLTRMKIEKCTVDIDSQMFTAFTIYQFILC YCTPLVLIAFFYTKLLSKLREHTRTFKSSQIPFLHISLYTLAVACFYFLCWTPFWMATLF AVYLENSANSSSVPPVFVYIMYFIHALPFTNSAINWILYGALNGQLQQRYRSNRSNSTKK TTTTTASTALLEKKITNLNTNSNYQVNGSMNSIATAAPTKTIGNNEVLVATSTIDDDVAT DVVDVRLLSNHNPTFL
Uniprot No.

Target Background

Function
Putative receptor.
Gene References Into Functions
  1. Caenorhabditis elegans possesses an endogenous opioid system that operates through NPR-17. PMID: 25898004
Database Links

KEGG: cel:CELE_C06G4.5

STRING: 6239.C06G4.5

UniGene: Cel.10869

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of C06G4.5 within the GPCR family?

C06G4.5 belongs to the adhesion-type 7-transmembrane (TM) G-protein coupled receptor family, similar to human GPR56. These receptors are characterized by long extracellular N-termini and feature a highly glycosylated mucin-like stalk followed by a GPCR proteolytic cleavage site (GPS) . The receptor contains identifiable transmembrane domains separated by short intracellular and extracellular regions. When studying C06G4.5, researchers should consider examining the proteolytic cleavage patterns, as cleavage of the N-terminus is often necessary for efficient cell surface expression of related GPCRs .

What expression systems are most suitable for recombinant C06G4.5 production?

Based on experiences with similar GPCRs, mammalian expression systems typically yield the most functionally relevant C06G4.5 protein. When designing expression constructs, include a C-terminal tag (such as 6-His) to facilitate purification while ensuring the N-terminal domain remains accessible for interaction with potential ligands . For optimal expression, consider the following protocol parameters:

Expression SystemAdvantagesChallengesRecommended Culture Conditions
HEK293 cellsNative post-translational modificationsModerate yield37°C, 5% CO₂, DMEM + 10% FBS
CHO cellsStable glycosylation patternsHigher cost37°C, 5% CO₂, F-12K medium
Sf9 insect cellsHigher protein yieldDifferent glycosylation27°C, serum-free medium

How can I verify the functional integrity of recombinant C06G4.5?

To confirm that your recombinant C06G4.5 maintains functional integrity, conduct adhesion assays similar to those performed with related GPCRs. Specifically, coating plates with human fibronectin (0.1 μg/mL) and the recombinant receptor (10 μg/well) should demonstrate a 2-4 fold increase in cell adhesion compared to fibronectin alone . Additionally, monitor proteolytic processing by Western blot, as proper cleavage of the N-terminal domain is critical for trafficking to the cell surface, similar to other adhesion GPCRs .

What are the key conserved domains in C06G4.5 that should be preserved in recombinant constructs?

When designing recombinant constructs, ensure preservation of the following critical domains based on GPCR structural studies:

  • The GPS (GPCR proteolytic site) motif - essential for processing

  • The "CWxP" motif containing W6.48 - critical for activation mechanics

  • The PIF (P5.50, I3.40, and F6.44) motif - involved in transmembrane rearrangements

  • The DRY motif - crucial for G-protein interaction

  • The NPxxY motif - involved in activation

Disruption of these conserved regions may result in non-functional protein despite successful expression.

What is the typical tissue distribution pattern for C06G4.5?

While specific C06G4.5 distribution data is limited, related adhesion GPCRs like GPR56 show widespread distribution with highest expression in neural tissues, thyroid, skin, and reproductive systems . When studying expression patterns, use multiple detection methods (qPCR, Western blotting, immunohistochemistry) to verify findings, as single detection methods may yield incomplete results.

How can structural studies of C06G4.5 inform drug design?

Structural studies of C06G4.5 can significantly enhance structure-based drug design (SBDD) approaches. Recent advancements in GPCR structural biology using crystallography and cryo-EM have revealed that capturing multiple conformational states (inactive, transitional, active, and apo) provides critical insights into ligand recognition and receptor activation mechanisms . For C06G4.5 research, consider:

  • Employing hydrogen-deuterium exchange (HDX) to map ligand-binding regions

  • Using site-directed mutagenesis of conserved motifs to assess their roles in signal transduction

  • Developing nanobodies that stabilize specific conformational states

  • Implementing molecular dynamics simulations to study conformational changes

These approaches can reveal unique binding pockets and allosteric sites that may be targeted for selective modulation of C06G4.5 function .

What methodologies are most effective for studying C06G4.5 activation mechanisms?

To study C06G4.5 activation mechanisms comprehensively, implement multiple complementary approaches:

MethodologyApplicationData OutputLimitations
BRET/FRET assaysReal-time conformational changesQuantitative energy transferRequires fusion proteins
Calcium flux assaysDownstream signalingFluorescence intensityLimited to Gq-coupled pathways
cAMP accumulationG-protein signalingConcentration curvesLimited to Gs/Gi pathways
ERK phosphorylationMAPK pathway activationWestern blot quantificationMultiple pathway convergence
Arrestin recruitmentReceptor desensitizationLuminescence/fluorescenceMay alter receptor kinetics

When interpreting results, consider that ligand-binding kinetics and signaling timing add another dimension for interpreting signal bias profiles and linking in vitro bioactivities with in vivo effects .

How can I investigate biased signaling in C06G4.5?

To investigate biased signaling in C06G4.5, design experiments that simultaneously measure multiple signaling pathways. Given that GPCRs can preferentially activate G-protein versus arrestin pathways, implement:

  • Parallel measurement of G-protein activation (using BRET-based G-protein dissociation assays) and arrestin recruitment

  • Assessment of multiple downstream effectors (cAMP, Ca²⁺, ERK1/2) with consistent time points

  • Calculation of bias factors using operational models that account for both efficacy and potency

  • Correlation of in vitro bias with ex vivo tissue responses

For meaningful comparison across experiments, always include reference ligands with established signaling profiles to normalize responses .

What are the best approaches for studying C06G4.5 in different model systems?

When studying C06G4.5 across different model systems, employ CRISPR/Cas9 technology for precise genetic manipulation . Consider these system-specific approaches:

  • Cell lines: Generate stable knockout and knockin lines to study receptor function in isolation

  • Primary cells: Use adeno-associated virus (AAV) for efficient gene delivery

  • Organoids: Implement inducible expression systems to study temporal effects

  • Animal models: Develop conditional knockout models using tissue-specific promoters

For cross-system validation, perform comparative pharmacological profiling using standardized assays across all models.

How can I resolve contradictory data in C06G4.5 signaling studies?

When confronted with contradictory data in C06G4.5 signaling studies:

  • Examine experimental conditions closely - particularly temperature, pH, ionic composition, and cell density

  • Assess receptor expression levels - variable expression can dramatically alter signaling profiles

  • Consider post-translational modifications - differences in receptor processing can affect function

  • Analyze temporal aspects - signaling pathways have distinct kinetics and may appear contradictory when measured at different time points

  • Evaluate the presence of endogenous modulatory proteins - cell-specific factors may influence receptor function

Document all experimental parameters thoroughly to enable proper interpretation and replication of results.

How should I design experiments to study C06G4.5 ligand binding?

When designing experiments to study C06G4.5 ligand binding, consider the following methodological approach:

  • Binding assay selection: For adhesion GPCRs like C06G4.5, traditional radioligand binding may be challenging due to the complex nature of potential ligands. Consider implementing surface plasmon resonance (SPR) or bioluminescence resonance energy transfer (BRET)-based proximity assays .

  • Protein preparation: Express the extracellular domain (ECD) separately from the transmembrane domain (TMD) to identify domain-specific interactions, similar to the two-domain-binding model established for Class B GPCRs .

  • Competition design: When testing potential ligands, include both known adhesion molecules and peptides to account for the diverse binding capabilities of adhesion GPCRs.

  • Data analysis: Apply both one-site and two-site binding models in your analysis, as adhesion GPCRs often display complex binding kinetics with multiple interaction sites.

What controls are essential in C06G4.5 research?

Implement these essential controls in C06G4.5 research:

Control TypePurposeImplementation
Expression controlVerify receptor levelsWestern blot/flow cytometry with anti-tag antibody
Cleavage controlConfirm proper processingCompare wild-type to GPS site mutant
Localization controlVerify surface expressionSurface biotinylation or non-permeabilized immunostaining
Functional negative controlEstablish baselineInactive mutant (DRY motif modification)
System controlAccount for endogenous effectsParental cells without receptor expression
Cross-reactivity controlVerify specificityRelated GPCR expression

How can I quantify C06G4.5 activation in cellular assays?

To quantify C06G4.5 activation in cellular assays, implement multiple readouts to capture the full signaling spectrum:

  • G-protein activation: Use BRET-based sensors to measure G-protein dissociation in real-time

  • Downstream signaling: Measure second messengers (cAMP, Ca²⁺, IP₃) at multiple time points

  • Pathway activation: Assess ERK phosphorylation using in-cell Western or HTRF technology

  • Receptor trafficking: Monitor internalization using pH-sensitive fluorescent tags

  • Transcriptional responses: Implement luciferase reporter assays for pathway-specific transcription factors

Present data as concentration-response curves and calculate EC₅₀/IC₅₀ values along with maximum efficacy measurements to enable comparisons across different experimental conditions.

What computational tools are available for C06G4.5 research?

Several computational tools can enhance C06G4.5 research:

  • Homology modeling: Use MODELLER or SWISS-MODEL with known GPCR structures as templates

  • Molecular dynamics: Implement GROMACS or AMBER to simulate receptor dynamics

  • Docking software: Utilize AutoDock Vina or Glide for ligand-binding prediction

  • Machine learning approaches: Apply deep learning models trained on GPCR data to predict ligand interactions

  • Pathway analysis: Use DAVID or GSEA to interpret transcriptomic responses to receptor activation

How can I design CRISPR experiments to study C06G4.5 function?

For effective CRISPR-based studies of C06G4.5:

  • Guide RNA design: Select targets in conserved domains (DRY motif, NPxxY motif) to create predictable functional alterations

  • Knockin strategy: Design precise modifications to study specific aspects (phosphorylation sites, binding motifs)

  • Screening approach: Implement fluorescent-based functional assays for high-throughput screening of edited cells

  • Validation methods: Confirm genomic modifications by sequencing and functional changes with signaling assays

  • Controls: Include non-targeting guides and rescue experiments with wild-type expression

Document off-target effects thoroughly by conducting whole-genome sequencing on selected clones.

What are the advantages and limitations of different expression systems for C06G4.5?

Different expression systems offer distinct advantages and limitations for C06G4.5 research:

Expression SystemAdvantagesLimitationsBest Applications
HEK293T cellsHuman post-translational modifications; High transfection efficiencyLimited protein yield; Adherent growthSignaling studies; Trafficking analysis
CHO cellsStable expression; Compatible with industrial processesSlower growth; More expensive mediaStable cell line generation; Long-term studies
Sf9/Sf21 cellsHigh protein yield; Growth in suspensionNon-mammalian glycosylation; Different membrane compositionProtein production for structural studies
E. coliQuick growth; High yield; EconomicalLimited post-translational modifications; Inclusion body formationExpression of soluble domains; Isotope labeling
Cell-free systemsRapid expression; Accommodation of toxic proteinsLimited post-translational modifications; High costInitial screening; Directed evolution

For most functional studies, mammalian systems are preferable despite lower yields, as they provide the most physiologically relevant post-translational modifications and membrane environment .

How can I validate antibodies targeting C06G4.5?

To rigorously validate antibodies targeting C06G4.5:

  • Expression validation: Test antibodies in systems with controlled expression (overexpression and knockout)

  • Specificity assessment: Perform immunoprecipitation followed by mass spectrometry

  • Epitope mapping: Use peptide arrays to identify precise binding regions

  • Cross-reactivity testing: Evaluate against related GPCRs and in tissues from knockout models

  • Application-specific validation: Test separately for Western blot, immunoprecipitation, and immunohistochemistry

Document batch-to-batch variation and establish internal reference standards for long-term studies.

What are the best practices for reporting C06G4.5 research findings?

When reporting C06G4.5 research:

  • Construct details: Provide complete sequence information including tags and linkers

  • Expression conditions: Document cell type, culture conditions, and expression levels

  • Assay parameters: Report all buffer compositions, incubation times, and temperatures

  • Data analysis: Clearly describe normalization methods and statistical approaches

  • Reagent validation: Include evidence of antibody specificity and reagent quality control

For pharmacological studies, report both potency (EC₅₀/IC₅₀) and efficacy (Emax) values with appropriate statistical analysis.

How can I assess biased signaling quantitatively in C06G4.5?

To quantitatively assess biased signaling:

  • Multiple pathway measurement: Simultaneously measure G-protein activation, arrestin recruitment, and downstream effectors

  • Reference ligand selection: Include a balanced reference ligand to normalize responses

  • Concentration-response curves: Generate full curves for each pathway to determine both potency and efficacy

  • Bias calculation: Apply the operational model to calculate transduction coefficients (Δlog(τ/KA))

  • Statistical analysis: Perform bootstrap analysis to determine confidence intervals for bias factors

Present bias data in radial plots to visualize multi-dimensional signaling preferences across pathways.

What emerging technologies might advance C06G4.5 research?

Several emerging technologies hold promise for advancing C06G4.5 research:

  • Cryo-electron microscopy: Enables structural determination without crystallization, particularly valuable for membrane proteins like GPCRs

  • Single-molecule FRET: Allows observation of conformational dynamics at the individual molecule level

  • Nanobody development: Creates tools to stabilize specific receptor conformations for structural and functional studies

  • Organoid models: Provides physiologically relevant systems to study receptor function in tissue context

  • AlphaFold2/RoseTTAFold: Improves structural prediction capabilities for regions lacking experimental structures

Early adoption of these technologies can provide competitive advantages in the rapidly evolving GPCR research landscape.

How is C06G4.5 research contributing to our understanding of GPCR biology?

Studies of adhesion GPCRs like C06G4.5 are expanding our understanding of GPCR biology in several key areas:

  • Alternative activation mechanisms: Unlike many GPCRs that require external ligands, adhesion GPCRs can potentially be activated by their own N-terminal fragments (tethered agonism)

  • Dual functionality: These receptors function both as adhesion molecules and signaling receptors

  • Development roles: Many adhesion GPCRs have crucial functions in tissue development and organization

  • Mechanical signal transduction: These receptors may translate mechanical forces into biochemical signals

Future work on C06G4.5 will likely contribute to these emerging concepts in GPCR biology.

What are unresolved questions about C06G4.5 function?

Several critical questions about C06G4.5 function remain unresolved:

  • Endogenous ligand identification: What are the natural binding partners?

  • Signaling preferences: Which G-protein subtypes couple to the receptor?

  • Regulatory mechanisms: How is receptor expression and function regulated in different tissues?

  • Physiological roles: What are the consequences of receptor dysfunction in vivo?

  • Evolutionary conservation: How are functions preserved across species?

Addressing these questions will require integrative approaches combining genomics, proteomics, structural biology, and in vivo studies.

What are the translational aspects of C06G4.5 research?

Translational aspects of C06G4.5 research include:

  • Therapeutic target potential: Based on patterns observed with other GPCRs, C06G4.5 may represent a novel drug target

  • Biomarker development: Expression patterns may serve as diagnostic or prognostic indicators

  • Structure-based drug design: Structural insights can guide development of specific modulators

  • Monoclonal antibody approaches: Antibodies targeting specific domains might modify receptor function

  • Gene therapy considerations: For disorders involving receptor dysfunction

When pursuing translational research, consider both on-target effects and potential cross-reactivity with related receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.