Recombinant Probable Golgi transport protein 1 (F41C3.4)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Probable Golgi Transport Protein 1 (F41C3.4) is a Caenorhabditis elegans protein involved in intracellular trafficking processes, particularly associated with Golgi complex function. Produced recombinantly in Escherichia coli, this protein is tagged with a hexahistidine (His) sequence for purification and experimental applications . Its UniProt ID is Q20263, and it is also referred to as eas-1 (enlarged amphid sheath glia protein 1) . While its exact mechanistic role remains under investigation, bioinformatics analyses and interaction studies suggest involvement in vesicle-mediated transport pathways .

Interaction Network

  • Pathway Association: Enriched in "vesicle-mediated transport" and "ER-to-Golgi vesicle-mediated transport" based on Gene Ontology (GO) analysis .

  • Interacting Partners:

    • Rab GTPases: Direct interaction with Rab1B via its EF34 domain, suggesting a role in ER-derived vesicle trafficking .

    • COPII/COPI Vesicles: Associates with SEC16A, SAR1, and components of COPII/COPI-coated vesicles .

Subcellular Localization

Localizes to Golgi membranes and transport intermediates, as inferred from homologous proteins (e.g., Erd1 in yeast), which chaperone glycosyltransferases during COPI-dependent recycling .

Experimental Uses

  • Binding Studies: Utilized in GST pull-down and surface plasmon resonance (SPR) assays to map interactions with Rab GTPases .

  • Enzyme Recycling: Investigated in models of Golgi-resident enzyme retention and retrograde transport .

Genetic Interactions

  • Suppressor Screens: Multicopy suppressors of erd1 mutants (e.g., Gyp1, COG complex subunits) highlight functional overlap with Golgi quality control pathways .

  • Phenotypic Defects: Mutants exhibit sensitivity to hygromycin and disrupted glycosylation, mirroring defects in Golgi enzyme recycling .

Comparative Analysis with Homologs

FeatureF41C3.4 (C. elegans)Erd1 (Yeast)
FunctionVesicle trafficking adapterChaperones Golgi enzymes
Binding PartnersRab1B, COPII/COPI componentsVps74, COPI vesicles
Genetic InteractionsRab GTPases, SEC16ACOG complex, GARP tethering
PhenotypeGolgi morphology defectsGlycosylation defects

Challenges and Future Directions

  • Mechanistic Clarity: The precise role of F41C3.4 in ER-Golgi transport remains unresolved. Structural studies (e.g., cryo-EM) could elucidate its interaction interfaces.

  • In Vivo Validation: Knockout models in C. elegans are needed to confirm its role in amphid sheath glia development and Golgi function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
eas-1; F41C3.4; Probable Golgi transport protein 1; Enlarged amphid sheath glia protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F41C3.4
Target Protein Sequence
MMNFEVSTTKQIGVGLTTFGFFFIFLGVLMFLDSALLAIGNLLFIVGITFIIGVQRTLVF FFEFRKLKGSILFFGGILVVLFGYPLFGMIAECWGFIVLFGGFLPGIVNLLRSIPGISTI TYLPGIRQVLDRLAPESKYPV
Uniprot No.

Target Background

Function
May be involved in the fusion of ER-derived transport vesicles with the Golgi complex.
Database Links

KEGG: cel:CELE_F41C3.4

STRING: 6239.F41C3.4

UniGene: Cel.22159

Protein Families
GOT1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Probable Golgi Transport Protein 1 (F41C3.4)?

Probable Golgi Transport Protein 1 (F41C3.4) is a protein involved in the transport mechanisms within the Golgi apparatus, particularly in facilitating the movement of cargo molecules through the Golgi stack. This protein likely plays a role in maintaining the structural integrity of Golgi cisternae while also facilitating transport between different Golgi compartments. Based on research on similar Golgi transport proteins, F41C3.4 may be involved in mediating intercisternal continuities that allow for diffusion-based transport of soluble proteins across the Golgi complex .

How does F41C3.4 relate to known Golgi trafficking mechanisms?

F41C3.4 likely participates in one or more of the established Golgi trafficking pathways. Current research identifies multiple coexisting transport mechanisms within the Golgi, including compartment progression-maturation for large cargo like procollagen, and diffusion via intercisternal continuities for soluble proteins like albumin . The Golgi apparatus utilizes these different transport modes simultaneously to accommodate diverse cargo types. F41C3.4 may function in facilitating the diffusion-based rapid transport of soluble proteins by helping establish or maintain intercisternal connections.

What experimental systems are suitable for studying F41C3.4?

The most appropriate experimental systems for studying F41C3.4 include:

SystemAdvantagesLimitations
HeLa cellsWell-characterized Golgi structure, easy transfectionNot native expression context
HepG2 cellsRobust secretory pathway, appropriate for transport studiesMore complex than simpler cell lines
C. elegansNative expression context, genetic manipulation possibleMore challenging for biochemical analyses
In vitro reconstitutionIsolated components, mechanistic studiesLacks cellular context

When designing experiments, it's crucial to consider that different cargo types (soluble vs. aggregated) show distinct trafficking behaviors through the same Golgi apparatus . Therefore, experimental design should account for cargo-specific differences when evaluating F41C3.4 function.

What expression systems yield functional recombinant F41C3.4?

Several expression systems can be employed to produce recombinant F41C3.4, each with specific advantages:

Expression SystemYieldPost-translational ModificationsPurification TagsComments
E. coliHighLimitedHis, GST, MBPRapid production but may lack proper folding
Insect cellsModerateMore completeHis, FLAG, StrepBetter for complex eukaryotic proteins
Mammalian cellsLowerNative-likeHis, FLAG, GFPMost physiologically relevant
Cell-freeVariableLimitedMultiple optionsRapid screening of conditions

For F41C3.4, mammalian expression systems are often preferred to ensure proper folding and post-translational modifications critical for functional studies. When using GFP-tagged constructs for localization studies, validation experiments should confirm that the tagged protein exhibits expected trafficking kinetics similar to established cargo proteins like albumin .

What purification strategy maximizes F41C3.4 stability and function?

A multi-step purification protocol for recombinant F41C3.4 typically includes:

  • Affinity chromatography using an appropriate tag (His, FLAG or Strep)

  • Ion exchange chromatography to separate proteins based on charge differences

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

Throughout purification, it's critical to maintain conditions that preserve Golgi protein structure:

  • Buffer pH 7.2-7.4 to mimic Golgi lumen conditions

  • Inclusion of glycerol (5-10%) to stabilize protein structure

  • Addition of reducing agents to prevent disulfide bond formation

  • Temperature control (4°C) to minimize degradation

Since Golgi transport proteins often associate with membranes, detergent selection is crucial. Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) at concentrations just above CMC (critical micelle concentration) often provide the best balance between protein extraction and stability.

How can researchers distinguish between F41C3.4's role in different Golgi transport pathways?

To differentiate between potential roles of F41C3.4 in various transport mechanisms, researchers should employ multiple complementary approaches:

  • Cargo-specific trafficking assays:

    • Track soluble cargo (like albumin or α1-antitrypsin) that moves by diffusion

    • Monitor large aggregate cargo (like procollagen) that moves by compartment progression

    • Compare trafficking kinetics in wild-type versus F41C3.4-depleted cells

  • Visualization techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

    • High-resolution microscopy to visualize intercisternal connections

    • Live-cell imaging with differentially labeled cargoes to track simultaneous transport

  • Biochemical approaches:

    • Proximity labeling to identify F41C3.4 interaction partners

    • In vitro reconstitution of transport with purified components

    • Glycosylation kinetics as readout for transport efficiency

Research on similar transport proteins shows that proteins involved in establishing intercisternal connections would primarily affect rapid diffusion of soluble cargo like albumin but have minimal impact on slower-moving aggregated cargo like procollagen .

What methodologies effectively measure F41C3.4's impact on protein transport kinetics?

To quantitatively assess F41C3.4's influence on protein transport kinetics, researchers should implement:

  • Pulse-chase analysis:

    • Radioactive or fluorescent labeling of cargo proteins

    • Monitoring arrival at specific Golgi compartments using compartment-specific markers (GM130 for cis-Golgi, TGN46 for trans-Golgi)

    • Quantification of cargo progression rates under F41C3.4 perturbation

  • FRAP-based kinetic measurements:

    • Photobleaching of fluorescently-tagged cargo in the Golgi region

    • Measuring recovery half-times (t1/2) for different cargo types

    • Comparative analysis between control and F41C3.4-depleted conditions

  • Cargo processing assays:

    • Monitoring glycosylation state changes for glycoproteins

    • Assessing acquisition of Endo H resistance as cargo progresses through the Golgi

    • Measuring secretion rates for fully processed cargo

Data analysis should include statistical comparisons of transport rates between different cargo types. For example, soluble proteins typically traverse the Golgi stack with half-times of 3-4 minutes, while aggregated cargo like procollagen requires significantly longer transit times .

How does F41C3.4 potentially contribute to intercisternal continuities?

Based on studies of Golgi transport mechanisms, F41C3.4 might contribute to intercisternal continuities through several possible mechanisms:

  • Membrane curvature induction:

    • Recognizing or inducing membrane curvature at cisternal rims

    • Stabilizing highly curved membrane domains

    • Recruiting additional factors that promote tubule formation

  • Tubule stabilization:

    • Preventing breakdown of formed intercisternal connections

    • Maintaining luminal continuity between adjacent cisternae

    • Coordinating with cytoskeletal elements for structural support

  • Regulated gate function:

    • Controlling selective permeability of connections

    • Facilitating passage of diffusible cargo while restricting others

    • Temporal regulation of continuity opening and closing

Experimental evidence from similar systems suggests that these connections are likely transient and regulated, allowing for efficient transport of soluble cargo like albumin while maintaining Golgi compartmentalization .

What controls are essential when studying F41C3.4 function in transport assays?

When designing transport assays to study F41C3.4 function, incorporate these critical controls:

How can researchers reconcile contradictory findings about F41C3.4 function?

When faced with conflicting results regarding F41C3.4 function, consider these analytical approaches:

  • Evaluate experimental conditions:

    • Cell type differences (specialized secretory cells vs. standard lines)

    • Expression levels of recombinant protein (physiological vs. overexpression)

    • Assay sensitivity and temporal resolution

    • Cargo-specific effects that might vary between studies

  • Apply integrative analysis:

    • Combined analysis of multiple datasets using standardized metrics

    • Meta-analysis approaches for published literature

    • Weighting evidence based on methodological rigor

  • Hypothesis refinement:

    • Develop models that accommodate seemingly contradictory observations

    • Consider context-dependent functions or redundancy with other factors

    • Test whether F41C3.4 participates in multiple transport pathways with different roles

When analyzing transport mechanisms, remember that the Golgi employs multiple simultaneous transport modes, which can complicate interpretation of knockout phenotypes or functional studies .

What techniques provide the most reliable quantitative data for F41C3.4 studies?

For generating robust quantitative data on F41C3.4 function, researchers should prioritize:

  • Live-cell imaging approaches:

    • FRAP with automatic thresholding for unbiased co-localization measures

    • Fluorescence correlation spectroscopy for protein dynamics

    • Ratiometric imaging to control for expression level variations

  • Biochemical quantification:

    • Pulse-chase with precise temporal sampling

    • Mass spectrometry-based protein quantification

    • Enzyme activity assays for processing cargo

  • High-throughput approaches:

    • Flow cytometry for population-level analysis

    • Automated image analysis with machine learning algorithms

    • Parallel cargo tracking with spectral separation

  • Statistical analysis:

    • Mixed-effects models to account for experimental variability

    • Appropriate multiple comparison corrections

    • Power analysis to determine sample sizes

For co-localization studies specifically, methods that employ automatic thresholding and account for random overlap are significantly more reliable than visual assessment or simple overlap coefficients .

How might F41C3.4 function differ across specialized secretory cells?

Different cell types exhibit varying secretory demands and Golgi organization patterns, potentially affecting F41C3.4 function:

Cell TypeSecretory SpecializationPotential F41C3.4 Adaptations
HepatocytesHigh-volume serum protein secretionEnhanced diffusion pathways for soluble cargo
FibroblastsECM component secretion (collagen)Balance between diffusion and maturation pathways
Pancreatic β-cellsRegulated insulin secretionTemporal regulation of transport routes
Plasma cellsAntibody secretionHighly developed diffusion capacity
NeuronsPolarized protein deliverySpecialized sorting mechanisms

Research indicates that cells may adjust their transport mechanisms based on the predominant cargo being transported. For example, during spermatid development, there is a proliferation of intracisternal tubules that may coincide with increased transport of cargoes dependent on the diffusional mode .

What computational models best predict F41C3.4's role in transport dynamics?

Computational approaches to modeling F41C3.4 function should incorporate:

  • Multi-scale modeling:

    • Molecular dynamics simulations of protein-membrane interactions

    • Mesoscale models of tubule formation and stability

    • Whole-Golgi models of cargo flux and compartmentalization

  • Key parameters to include:

    • Diffusion coefficients for different cargo types

    • Dimensions and frequency of intercisternal connections

    • Enzyme distribution across Golgi compartments

    • Cargo concentration effects

  • Validation approaches:

    • Parameter sensitivity analysis

    • Testing model predictions with targeted experiments

    • Fitting to experimental FRAP recovery curves and transport kinetics

Current research suggests that diffusion-based transport models can accurately predict the rapid equilibration of soluble proteins across Golgi compartments, while cisternal maturation models better explain the movement of large aggregates .

How does F41C3.4 potentially integrate with other Golgi transport mechanisms?

F41C3.4 likely functions within a complex network of transport mechanisms, potentially interacting with:

  • Vesicular transport components:

    • COPI/COPII machinery

    • Tethering factors and SNAREs

    • Rab GTPases that regulate vesicle formation

  • Cisternal maturation machinery:

    • Proteins involved in lipid composition changes

    • Glycosylation enzymes that relocate during maturation

    • Structural proteins maintaining cisternal architecture

  • Tubular connection regulators:

    • Membrane curvature-inducing proteins

    • Lipid-modifying enzymes that affect membrane properties

    • Cytoskeletal elements that provide structural support

Research demonstrates that diffusion-based transport of soluble proteins and cisternal progression transport of aggregated proteins occur simultaneously within the same Golgi stacks . This suggests F41C3.4 must function in coordination with, rather than in opposition to, other transport mechanisms to maintain Golgi functionality.

What are the most promising directions for future F41C3.4 research?

Future research on F41C3.4 should prioritize:

  • Structure-function relationships:

    • High-resolution structural studies (cryo-EM, X-ray crystallography)

    • Mapping functional domains through directed mutagenesis

    • Identifying critical residues for membrane interaction

  • System-level understanding:

    • Comprehensive interactome mapping

    • Regulatory mechanisms controlling F41C3.4 activity

    • Integration with other Golgi transport pathways

  • Physiological relevance:

    • Tissue-specific functions and adaptations

    • Developmental regulation of expression

    • Consequences of dysfunction in disease models

  • Therapeutic applications:

    • Potential targeting in disorders of protein trafficking

    • Bioengineering applications for enhanced protein production

    • Diagnostic markers for Golgi dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.