Recombinant Probable intracellular septation protein A (VV1_3073)

What is Recombinant Probable intracellular septation protein A (VV1_3073)?

Recombinant Probable intracellular septation protein A (VV1_3073) is a protein originally derived from Vibrio vulnificus that plays a critical role in bacterial cell division processes. It is classified as a probable intracellular septation protein, suggesting its involvement in the formation of the septum during bacterial cell division. The recombinant form refers to the protein produced through molecular cloning techniques rather than extracted directly from the source organism. The protein is identified by its Uniprot accession number P59366 and consists of 187 amino acids in its full-length form .

What is the amino acid sequence and structural composition of VV1_3073?

The complete amino acid sequence of VV1_3073 is: MKQILDFIPLIIFFALYKMYDIYVATGALIAATAIQIVVTYALYKKVEKMQLITFLMVAIFGGMTIFLHDDNFIKWKVTIVYAVFAIGLTVSHMGKSAIKGMLGKEITLPESVWANINWAWVGFFTFCAGLNIYVAYQLPLDVWVNFKVFGLLAATLVFTVLTGGYIYKHLPKEQNGQSSDVPTDE. This sequence contains several hydrophobic regions consistent with its predicted membrane association. The protein's structural elements likely include transmembrane domains similar to other septation proteins, which facilitate its integration into the cell membrane during the division process .

How should researchers store and handle this recombinant protein?

For optimal stability and activity maintenance, Recombinant Probable intracellular septation protein A should be stored at -20°C, and for extended storage periods, conservation at -20°C or -80°C is recommended. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized specifically for this protein. When working with the protein, it's advisable to create working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles which can compromise protein integrity. Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of biological activity .

What expression systems are most effective for producing VV1_3073?

While the search results don't specifically address expression systems for VV1_3073, drawing from research on related septation proteins, E. coli-based expression systems under the control of inducible promoters such as the trc or arabinose-inducible promoters have proven effective. For septation proteins, expression vectors like pET-28a (which provides an N-terminal His-tag for purification) or pBAD systems (allowing tight regulation of expression levels) have been successfully employed. When designing expression constructs, researchers should consider including affinity tags that will not interfere with the protein's membrane localization properties. Optimization of induction conditions including temperature, inducer concentration, and duration will be necessary to maximize soluble protein production .

How can researchers study the localization patterns of VV1_3073 in bacterial cells?

Green Fluorescent Protein (GFP) fusion constructs represent a powerful approach for studying the localization patterns of septation proteins like VV1_3073. Based on techniques used with other septation proteins, researchers can design GFP-VV1_3073 fusion constructs where GFP is fused to the C-terminal end of the protein. This approach allows for real-time visualization of protein localization during bacterial cell division using fluorescence microscopy. When designing such constructs, care should be taken regarding the position of the GFP tag to minimize interference with protein function. Microscopic analysis should include measurements of cell length and quantification of the percentage of cells showing fluorescent rings at potential division sites to assess proper localization .

What protein-protein interaction methods are suitable for identifying VV1_3073 binding partners?

For identifying protein-protein interactions involving VV1_3073, several complementary approaches can be employed. Pull-down assays using His-tagged versions of the protein can effectively capture interacting partners from cell lysates. Bacterial two-hybrid systems are particularly suited for membrane proteins and can identify direct interactions in vivo. Co-immunoprecipitation with antibodies against VV1_3073 or its tagged version can isolate native protein complexes. When designing these experiments, researchers should consider the membrane-associated nature of the protein and employ detergents that solubilize the protein while preserving its interactions. Controls should include mutations in putative interaction domains to validate specific binding regions .

What are the key functional domains in VV1_3073 and how do they compare to other septation proteins?

Based on structural analysis of related septation proteins, VV1_3073 likely contains distinctive functional domains including a short intracellular N-terminal region, a transmembrane anchor domain, and a catalytic or interaction domain. By comparison with PBP3 (a well-studied septation protein), VV1_3073 may contain segments with protein-protein interaction potentials that facilitate its incorporation into the divisome complex. The protein's sequence suggests it includes membrane-spanning regions that anchor it to the bacterial cell membrane, positioning its functional domains appropriately for participation in the septation process. Specific regions within these domains likely contain conserved residues that are essential for protein function and could serve as targets for site-directed mutagenesis studies .

How does the membrane-spanning domain affect the function of VV1_3073?

The membrane-spanning domain of VV1_3073, like other septation proteins, plays a crucial role in proper localization to the division site. This domain anchors the protein to the bacterial cell membrane, orienting the functional domains correctly for interaction with other divisome components. Studies of related proteins suggest that alterations to the membrane anchor can significantly affect protein function and localization. For instance, in PBP3, substitution of the membrane anchor with an uncleavable lipoprotein signal peptide prevented the protein from competing with wild-type protein, indicating the importance of the membrane anchor for proper protein targeting and function. Similar functional dependence on membrane anchoring is likely for VV1_3073 .

What residues are critical for the septation function of VV1_3073?

While specific residue information for VV1_3073 is limited in the provided search results, research on related septation proteins suggests that certain conserved amino acids are likely critical for function. Based on studies of PBP3, key residues might include arginine residues in interaction domains and catalytic residues in functional domains. In PBP3, mutations of Arg210 and Arg213 to glutamine resulted in a protein that could still bind penicillin but exhibited a dominant-negative phenotype, preventing cell division. Similar conserved basic residues in VV1_3073 might play analogous roles in protein-protein interactions essential for septation. Identification of these critical residues would require site-directed mutagenesis studies followed by functional assays .

How can mutations in VV1_3073 be designed to understand protein function?

Designing mutations in VV1_3073 should target conserved residues or domains predicted to be involved in protein-protein interactions or catalytic activity. Based on research with PBP3, systematic mutation of charged residues (particularly arginine residues) in putative interaction domains can reveal functional regions. Double or triple mutations may be necessary to observe phenotypic effects. Mutations should be designed to maintain protein folding while altering specific functional properties. The experimental design should include both conservative substitutions (maintaining charge characteristics) and non-conservative changes. Each mutant should be assessed for expression levels, stability, localization, and functional impact on cell division. Complementation assays with wild-type protein can help determine if mutations cause dominant-negative effects .

What approaches can assess the dominant-negative effects of VV1_3073 mutants?

To assess dominant-negative effects of VV1_3073 mutants, researchers can employ several approaches based on techniques used with other septation proteins. Overexpression of mutant proteins in wild-type bacterial strains can reveal competition with endogenous protein function. Cell morphology analysis, particularly cell length measurements, can quantify division defects. GFP fusion constructs allow for simultaneous assessment of protein localization and dominant-negative effects. Temperature-sensitive strains can be particularly useful, as they allow for conditional expression systems. The following table outlines potential experimental outcomes when assessing dominant-negative effects:

This approach can identify which protein domains are essential for function versus localization .

How can GFP fusion constructs be optimized for studying VV1_3073 localization?

Optimization of GFP fusion constructs for VV1_3073 localization studies requires careful consideration of several factors. The fusion position should preserve protein function - C-terminal fusions often work well for septation proteins, as evidenced by successful GFP-PBP3 constructs. Expression levels must be carefully controlled, as overexpression can lead to artifacts; using weakened promoters (like the weakened trc promoter) can achieve near-physiological expression levels. The linker sequence between GFP and VV1_3073 should be designed to provide flexibility without compromising folding. Controls should include wild-type protein fusions alongside mutant variants. Microscopy conditions should be standardized, with measurements of cell length and quantification of fluorescent ring formation. Based on studies with PBP3, researchers should expect to see fluorescent rings at the division site in approximately 60-80% of cells when the fusion protein is properly localized .

What techniques can reveal the interaction network of VV1_3073 in the divisome complex?

Uncovering the interaction network of VV1_3073 within the divisome complex requires a multi-faceted approach. Researchers should consider implementing bacterial two-hybrid screening to identify direct protein-protein interactions. Proximity-based labeling techniques such as BioID can capture both stable and transient interactions in vivo. Co-immunoprecipitation followed by mass spectrometry can identify native protein complexes. Based on studies with PBP3, likely interaction partners for VV1_3073 might include homologs of FtsQ, FtsL, and FtsW. Verification of these interactions should employ multiple methods, including FRET/BRET analysis for in vivo confirmation. Mutation of specific residues in putative interaction domains (similar to the R210Q, R213Q mutations in PBP3) can help map the specific regions involved in protein-protein interactions .

How can contradictory data regarding VV1_3073 function be reconciled in research contexts?

When facing contradictory data regarding VV1_3073 function, researchers should employ a systematic approach to reconciliation. First, experimental conditions should be thoroughly examined, as differences in protein expression levels, bacterial strains, growth conditions, or purification methods can significantly affect results. Second, the specific fusion constructs or mutations used should be compared, as even small differences in construct design can alter protein function. The table below outlines a framework for reconciling contradictory findings:

This structured approach helps distinguish between genuine biological variability and technical artifacts when interpreting seemingly contradictory results .

What high-throughput approaches can accelerate VV1_3073 characterization?

High-throughput approaches for accelerating VV1_3073 characterization include systematic mutagenesis coupled with phenotypic screening. Deep mutational scanning, where thousands of variants are simultaneously assessed for function, can rapidly identify critical residues. High-content imaging platforms can automate the analysis of protein localization patterns in large mutant libraries. Interactome mapping using protein microarrays or large-scale two-hybrid screens can efficiently identify interaction partners. Cryo-electron microscopy could reveal structural details of VV1_3073 within the divisome complex. Combining these approaches with computational modeling and bioinformatic analysis of related septation proteins can generate testable hypotheses about function and guide targeted experimental approaches. Integration of these methods can significantly accelerate understanding of VV1_3073's role in bacterial cell division .

How might VV1_3073 research inform broader understanding of bacterial cell division?

Research on VV1_3073 has the potential to expand our understanding of bacterial cell division mechanisms beyond model organisms. As a septation protein from Vibrio vulnificus, VV1_3073 represents cell division adaptations in a marine pathogen that may differ from well-studied organisms like E. coli. Comparative analysis with other septation proteins like PBP3 can reveal conserved functional principles across bacterial phyla. Detailed characterization of VV1_3073's role could identify novel regulatory mechanisms in the assembly and function of the divisome complex. Understanding species-specific aspects of septation proteins may also reveal potential targets for narrow-spectrum antibiotics that disrupt cell division in specific bacterial pathogens without broadly affecting the microbiome. The protein's structure-function relationships may additionally provide insights into the evolution of cell division machinery across bacterial species .

What are the current limitations in VV1_3073 research and how might they be overcome?

Current limitations in VV1_3073 research likely include challenges in protein expression and purification due to its membrane-associated nature. Based on experiences with similar proteins, researchers face difficulties in maintaining proper folding and activity when removing the protein from its membrane environment. Limited structural information hampers rational design of experiments targeting specific domains. The complex network of protein interactions in the divisome makes it challenging to isolate the specific function of VV1_3073. To overcome these limitations, researchers could develop membrane mimetic systems like nanodiscs or liposomes to study the protein in a near-native environment. Cryo-electron microscopy might bypass the need for protein crystallization. Genetic approaches in Vibrio vulnificus, rather than heterologous expression systems, could provide more physiologically relevant insights. Developing conditional depletion strains would allow for precise temporal control when studying essential division proteins. Collaborative approaches combining structural biology, genetics, and advanced imaging techniques will likely be necessary to fully characterize this complex membrane protein .