Recombinant Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

YciB is implicated in two critical cellular processes:

Cell Division and Elongation

  • Interacts with ZipA and ZapA, proteins stabilizing the Z-ring during septum formation .

  • Deletion mutants (ΔyciB) exhibit shorter cell length and sensitivity to low osmolarity .

  • Overexpression causes cell elongation and toxicity, suggesting dosage-dependent regulation .

Cell Envelope Integrity

  • Maintains membrane fluidity and lipoprotein maturation .

  • Synthetic lethality with dcrB (a lipoprotein gene) under low-salt conditions .

  • Rescued by overexpression of Lgt, an enzyme critical for lipoprotein modification .

Interaction Network

YciB partners with multiple membrane-associated proteins :

Interaction PartnerFunctionScore
YciCUPF0259 family inner membrane protein0.973
DcrBPhage adsorption lipoprotein0.591
GltKGlutamate/aspartate transporter0.533
RbsCRibose ABC transporter0.530

Mutant Phenotypes

  • ΔyciB Phenotype:

    • Increased sensitivity to copper ions (MIC: 2.25 mM vs. WT: >3 mM) .

    • Abnormal localization of division proteins (ZipA, ZapA) .

  • ΔyciB ΔdcrB Double Mutant:

    • Lethality in low-osmolarity media due to defective lipoprotein maturation .

    • Mislocalization of Lpp (major lipoprotein) to the inner membrane .

Recombinant Expression

  • Host Systems: E. coli (e.g., strain BL21) .

  • Purity: >85% (SDS-PAGE validated) .

  • Applications:

    • Study of bacterial cell division mechanisms .

    • Screening for antibiotics targeting membrane integrity .

    • Protein interaction mapping via bacterial two-hybrid systems .

Challenges and Limitations

  • Toxicity: High expression levels impair cell growth .

  • Stability: Requires glycerol-supplemented buffers to prevent aggregation .

  • Functional Redundancy: Partial functional overlap with RodZ in peptidoglycan synthesis .

Future Directions

  • Structural studies to resolve transmembrane domain architecture .

  • Engineering thermostable variants for industrial applications .

  • Investigating YciB homologs in pathogens (e.g., Yersinia pseudotuberculosis) for therapeutic targeting .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; c1720; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: ecc:c1720

STRING: 199310.c1720

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YciB and what is its cellular localization?

YciB (Probable intracellular septation protein A) is an inner membrane protein found in Escherichia coli. It is localized to the bacterial cell membrane where it appears to participate in cellular processes related to growth and division. The protein contains five transmembrane domains that anchor it within the inner membrane of the bacterial cell . Understanding this localization is crucial for designing experiments to study its function and interactions within the cellular environment.

What is the membrane topology of YciB?

The membrane topology of YciB consists of five transmembrane domains that span the inner membrane of E. coli. This topology was clarified through dedicated research efforts that likely employed techniques such as fusion protein analysis, protease accessibility studies, or fluorescence-based approaches . The transmembrane arrangement of YciB is fundamental to its function, as it positions specific protein domains for interaction with other cell division and elongation components within the bacterial cell.

What are the known structural characteristics of YciB?

YciB is characterized as a membrane protein with five transmembrane domains spanning the inner membrane of E. coli. While detailed three-dimensional structural information appears limited in the available research, the transmembrane organization has been clarified . This membrane topology provides the structural framework for YciB's functional interactions with other proteins involved in cellular processes. Further structural studies would likely require advanced techniques such as X-ray crystallography or cryo-electron microscopy to elucidate precise folding patterns and interaction domains.

What is the primary function of YciB in bacterial cells?

Research indicates that YciB is involved in the synthesis of the cell envelope through interactions with cell elongation and cell division complexes. While its exact function had not been fully identified in earlier studies, experimental evidence suggests it plays a role in maintaining cell envelope integrity, particularly under conditions of low osmolarity . The deletion mutant of yciB demonstrates susceptibility to low osmolarity environments, indicating its importance in maintaining cellular structural integrity under osmotic stress conditions .

What protein interactions does YciB participate in?

YciB has been shown to interact with various proteins involved in cell elongation and cell division based on bacterial two-hybrid system analysis. These interactions suggest YciB forms part of the complex protein machinery that coordinates cell envelope synthesis during growth and division . The specific protein partners identified through two-hybrid screening provide valuable insights into the functional network in which YciB operates. Characterizing these protein-protein interactions is essential for understanding YciB's role in coordinating cellular processes.

How does YciB contribute to bacterial cell stability?

Experimental evidence indicates that YciB contributes to bacterial cell stability, particularly in low osmotic environments. The deletion mutant of yciB shows increased susceptibility to low osmolarity conditions, suggesting the protein plays a role in maintaining cell integrity under osmotic stress . This function appears to be executed through YciB's interactions with cell elongation and division complexes, thereby influencing the proper synthesis and maintenance of the cell envelope structure. Further research into these mechanisms would enhance our understanding of bacterial adaptation to environmental challenges.

What techniques are effective for studying YciB membrane topology?

To effectively study YciB membrane topology, researchers can employ multiple complementary approaches:

  • Fusion protein analysis with reporter proteins (such as alkaline phosphatase or green fluorescent protein)

  • Cysteine scanning mutagenesis followed by accessibility studies

  • Protease protection assays to determine exposed regions

  • Computational prediction algorithms validated by experimental data

These methodologies allow for the mapping of transmembrane domains and determination of which protein regions face the cytoplasmic or periplasmic sides of the membrane. The research cited in the available literature successfully clarified YciB topology using such approaches . Experimental design should include appropriate controls and comparative analysis across multiple methods to ensure reliable topology determination3.

How can protein-protein interactions of YciB be effectively characterized?

The characterization of YciB protein interactions can be achieved through several methodological approaches:

  • Bacterial two-hybrid systems, as successfully employed in previous research

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET)

  • Bimolecular fluorescence complementation (BiFC)

  • Cross-linking studies followed by protein identification

When designing such experiments, researchers should consider variables that might affect interaction strength and specificity, including growth conditions, expression levels, and potential competitive inhibitors3. The experimental design should include positive and negative controls to validate the specificity of observed interactions and to ensure that the detection system functions properly .

What approaches are suitable for generating and analyzing YciB deletion mutants?

To generate and analyze YciB deletion mutants, researchers can implement the following approaches:

  • Generation methods:

    • Homologous recombination techniques (λ-Red recombination system)

    • CRISPR-Cas9 genome editing

    • Transposon mutagenesis followed by screening

  • Analysis methods:

    • Growth rate measurements under various osmotic conditions

    • Microscopic analysis of cell morphology

    • Examination of cell division patterns

    • Comparative transcriptomics and proteomics

    • Osmotic shock survival assays

The experimental design should include wild-type controls and complementation tests to verify that observed phenotypes are specifically attributable to the absence of YciB3. Variables such as media composition, growth phase, and environmental stressors should be systematically controlled and analyzed .

How does YciB function relate to bacterial stress responses?

The relationship between YciB and bacterial stress responses appears to center on osmotic stress handling. Evidence indicates that YciB deletion mutants exhibit susceptibility to low osmolarity conditions, suggesting the protein plays a role in maintaining cell envelope integrity during osmotic challenge . This function may be executed through:

  • Coordination with cell envelope synthesis machinery

  • Stabilization of protein complexes involved in cell wall maintenance

  • Signal transduction in response to osmotic changes

  • Regulation of membrane permeability

Future research directions could explore how YciB expression and function may be modulated under different stress conditions beyond osmotic challenge, such as pH shifts, temperature fluctuations, or exposure to antimicrobial compounds. Experimental approaches should incorporate gene expression analysis, protein localization studies under stress conditions, and careful phenotypic characterization of mutants versus wild-type strains3.

What is the relationship between YciB and bacterial cell division processes?

YciB has been found to interact with various proteins involved in cell division through bacterial two-hybrid system analysis . These interactions suggest YciB may function as part of the complex machinery that coordinates cell envelope synthesis during division. To further explore this relationship, researchers could:

  • Conduct live-cell imaging of fluorescently tagged YciB during the cell cycle

  • Analyze the localization patterns relative to known divisome components

  • Investigate the effects of YciB overexpression or depletion on septum formation

  • Examine genetic interactions between yciB and known cell division genes

The experimental approach should include time-course studies and spatial resolution of protein distributions during different stages of cell division3. Careful control of variables such as growth rate, media composition, and cell synchronization techniques would be essential for generating reproducible results .

How might YciB research inform antimicrobial development strategies?

Research on YciB could potentially inform antimicrobial development strategies through several avenues:

  • Target identification: As a membrane protein involved in cell envelope synthesis and division, YciB or its interaction partners might represent novel targets for antimicrobial compounds that disrupt these essential processes.

  • Mechanism understanding: Characterizing how YciB contributes to bacterial cell envelope integrity could reveal vulnerability points in bacterial physiology.

  • Stress response modulation: Understanding YciB's role in osmotic stress handling might lead to compounds that compromise bacterial adaptation to environmental challenges.

  • Structure-based drug design: Detailed structural information about YciB could facilitate the design of inhibitors that specifically disrupt its function or interactions.

Research approaches in this direction would require interdisciplinary collaboration between structural biologists, microbiologists, and medicinal chemists. Experimental design would need to include screening methodologies for compound libraries, structure-activity relationship studies, and careful evaluation of specificity and efficacy against target bacteria versus host cells3.

How should contradictory data about YciB function be analyzed?

When confronted with contradictory data regarding YciB function, researchers should implement a systematic analytical approach:

  • Methodological comparison: Evaluate differences in experimental methodologies that might explain contradictory results, including:

    • Growth conditions and media composition

    • Strain backgrounds and genetic modifications

    • Protein expression levels and tagging strategies

    • Measurement techniques and timepoints

  • Statistical rigor: Apply appropriate statistical analyses to determine if contradictions are statistically significant or within experimental variation .

  • Biological context: Consider how different experimental contexts might reveal different aspects of YciB function rather than true contradictions.

  • Independent validation: Design verification experiments using alternative approaches to test conflicting hypotheses.

The experimental design should incorporate controls that can help discriminate between competing models of YciB function3. Documentation of all variables and transparent reporting of methodological details are essential for resolving apparent contradictions in the literature .

What bioinformatic approaches can enhance YciB research?

Bioinformatic approaches can significantly enhance YciB research through:

  • Comparative genomics: Analysis of YciB conservation and variation across bacterial species can provide evolutionary insights into its function.

  • Structural prediction: Computational modeling of YciB structure based on sequence data and known membrane protein folding principles.

  • Interaction network analysis: Integration of experimental protein interaction data with known bacterial protein networks to identify functional modules.

  • Expression correlation analysis: Mining of transcriptomic databases to identify genes co-regulated with yciB under various conditions.

  • Pathway enrichment: Statistical analysis of interactions to identify significantly enriched cellular pathways connected to YciB function.

These computational approaches should be validated through targeted experimental testing of predictions3. Integration of multiple bioinformatic methods typically provides more robust insights than reliance on any single approach .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.