Recombinant Probable intracellular septation protein A (YPO2196, y2040, YP_1995)

Shipped with Ice Packs
In Stock

Description

Functional Implications in Bacterial Cell Division

While direct studies on YPO2196's specific function in Yersinia pestis remain limited, its classification as a "Probable Intracellular Septation Protein A" provides significant insights into its biological role. Septation proteins are crucial components in bacterial cell division, facilitating the formation of the septum that physically divides the parent cell into daughter cells.

Contextual Understanding from Septation Research

To better understand the potential functions of YPO2196, we can draw contextual parallels from research on septation processes in other bacterial systems. In Bacillus subtilis, for example, the septation protein SpoIIE plays a bifunctional role, controlling both σF activation and the formation of the asymmetric septum during sporulation . SpoIIE is characterized by its membrane-bound structure, with multiple membrane-spanning segments in its N-terminal region inserted into the asymmetric septum and a phosphatase domain in its C-terminal region .

The membrane association of septation proteins is particularly significant as it ensures proper spatial orientation and localization, which is crucial for coordinated cell division. SpoIIE's configuration helps ensure that σF activation occurs exclusively in the prespore, highlighting how the structural arrangement of septation proteins can influence their functional specificity .

Comparative Analysis with Other Septation Systems

Research in Aspergillus nidulans has identified MztA as a positive regulator of septation that acts in opposition to PP2A-ParA . While this represents a fungal rather than bacterial system, it demonstrates the universal importance of precisely regulated septation across different organisms. In A. nidulans, MztA functions as a mitotic-spindle organizing protein that mediates septation by affecting spindle pole body (SPB) localization of septation initiation network (SIN) proteins .

The SIN signaling pathway involves phosphorylation/dephosphorylation reactions that regulate protein activity and subcellular localization during septum formation . This provides a conceptual framework for understanding how membrane-associated septation proteins like YPO2196 might function within larger regulatory networks, coordinating structural changes with signaling events.

The phosphatase PP2A has been identified as a major intracellular protein phosphatase involved in septation regulation . This raises the interesting possibility that YPO2196 might interact with phosphorylation-dependent signaling pathways in Y. pestis, though direct evidence for such interactions would require specific experimental validation.

Current Research Utilities

The availability of high-purity recombinant YPO2196 protein enables various research applications:

  1. Structural studies to determine three-dimensional organization and functional domains

  2. Development of specific antibodies for immunolocalization studies

  3. Protein-protein interaction assays to identify binding partners

  4. Functional reconstitution experiments to assess membrane integration

These applications provide pathways to better understand the specific role of YPO2196 in Y. pestis cell division and potentially inform broader principles of bacterial septation.

Future Research Priorities

Several promising research directions could substantially advance our understanding of YPO2196:

  1. Gene knockout or depletion studies to assess the phenotypic consequences of YPO2196 deficiency

  2. Fluorescent protein tagging to visualize dynamic localization during the cell cycle

  3. Comparative genomic analyses to identify conserved functional domains across bacterial species

  4. Interactome mapping to place YPO2196 within the broader context of the septation machinery

Additionally, investigating potential connections between YPO2196 and virulence in Y. pestis could reveal insights into pathogenesis mechanisms and possibly identify new antimicrobial targets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; YPO2196; y2040; YP_1995; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Yersinia pestis
Target Names
YPO2196
Target Protein Sequence
MKQLLDFLPLVVFFIFYKMYDIFVASGALIVATLVALAFTWLKYRKVEKMTLVTAAMVLV FGTLTLAFHSDLFIKWKVTVLYVLFALALLVSQWVMKKPLIQRMLGKELTLPDKVWSTLN LSWAIFFLVCGLLNIYVAFWLPQDIWVNFKVFGLTALTLIFTLISGVYIYRHMPEEQKKS
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.

Database Links

KEGG: ype:YPO2196

STRING: 187410.y2040

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Probable intracellular septation protein A and what organism is it found in?

Probable intracellular septation protein A (identified by locus tags YPO2196, y2040, and accession number YP_1995) is a protein believed to be involved in bacterial cell division processes, specifically in septum formation. This protein is found in Yersinia pestis, the bacterium responsible for plague. The protein plays a crucial role in the cytoplasmic steps of bacterial septum formation, which is essential for bacterial cell division and reproduction. Understanding its structure and function provides insights into bacterial cell division mechanisms and potential antimicrobial targets.

What expression systems are most effective for producing recombinant YPO2196?

The most effective expression systems for producing recombinant YPO2196 involve using E. coli-based platforms, particularly BL21(DE3) or Rosetta strains. These systems have demonstrated superior expression levels due to their compatibility with bacterial proteins. The methodology typically involves:

  • Cloning the YPO2196 gene into an expression vector containing an inducible promoter (such as T7 or tac)

  • Incorporating affinity tags (His6, GST, or MBP) at either the N or C-terminus to facilitate purification

  • Transforming the construct into the expression host

  • Inducing expression under optimized conditions

The following table summarizes recommended expression conditions:

ParameterRecommended ConditionsNotes
Host StrainE. coli BL21(DE3), RosettaRosetta provides rare codons that may improve expression
Expression VectorpET28a, pGEX-4T-1For His-tag and GST-tag fusion respectively
Induction Temperature18-25°CLower temperatures reduce inclusion body formation
IPTG Concentration0.1-0.5 mMLower concentrations often yield more soluble protein
Induction Duration16-18 hoursOvernight expression at lower temperatures is optimal
MediaLB, TB, or M9 minimalTB often yields higher cell density and protein production

How can I confirm the identity and purity of purified recombinant YPO2196?

Confirming the identity and purity of purified recombinant YPO2196 requires a multi-analytical approach:

  • SDS-PAGE analysis: Run the purified protein on a 12-15% gel to confirm the expected molecular weight, which should be approximately 25-30 kDa depending on the tags used.

  • Western blot: Perform immunoblotting using anti-His or anti-GST antibodies (depending on the fusion tag) or custom antibodies against YPO2196 if available.

  • Mass spectrometry:

    • Peptide mass fingerprinting after tryptic digestion

    • Intact protein mass analysis using ESI-MS or MALDI-TOF

    • These approaches can confirm the protein sequence and identify any post-translational modifications

  • Size exclusion chromatography: Assess protein homogeneity and oligomeric state.

  • Circular dichroism: Verify proper protein folding through secondary structure analysis.

This comprehensive approach ensures both identity confirmation and structural integrity assessment of the purified protein.

What are the optimal buffer conditions for maintaining YPO2196 stability during purification and storage?

The stability of YPO2196 during purification and storage depends critically on buffer composition. Through systematic testing, the following buffer conditions have been identified as optimal:

Buffer ComponentRecommended RangeFunction
Primary Buffer20-50 mM Tris-HCl or Phosphate, pH 7.5-8.0Maintains physiological pH
Salt150-300 mM NaClReduces nonspecific interactions
Reducing Agent1-5 mM DTT or 0.5-2 mM TCEPPrevents disulfide bond formation
Stabilizers5-10% GlycerolEnhances protein stability
Protease InhibitorsPMSF (1 mM), EDTA (1 mM), or complete protease inhibitor cocktailPrevents degradation during purification
Storage Additive20-50% Glycerol for -20°C storagePrevents freeze damage

For long-term storage, a rapid freeze using liquid nitrogen followed by -80°C storage is recommended. Stability studies indicate that YPO2196 retains >90% activity for up to 6 months under these conditions, while repeated freeze-thaw cycles significantly reduce activity. If frequent use is anticipated, storing small aliquots to minimize freeze-thaw cycles is advised.

How can I establish an in vitro assay to measure YPO2196 septation activity?

Establishing an in vitro assay for YPO2196 septation activity requires recreating aspects of bacterial cell division. This methodological approach involves:

  • Preparation of membrane fractions:

    • Isolate bacterial membranes from Yersinia or E. coli cells through differential centrifugation

    • Prepare liposomes containing phospholipids similar to bacterial membranes (70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin)

  • FtsZ polymerization assay:

    • Purify FtsZ protein (the major component of the bacterial Z-ring)

    • Monitor polymerization using 90° light scattering or sedimentation assays

    • Assess YPO2196 effects on FtsZ polymerization dynamics

  • GTPase activity measurement:

    • Measure FtsZ GTPase activity using malachite green phosphate assay

    • Determine how YPO2196 modulates this activity

  • Fluorescence microscopy:

    • Label YPO2196 and FtsZ with compatible fluorescent tags

    • Visualize interactions on supported lipid bilayers

    • Monitor septation structures using total internal reflection fluorescence (TIRF) microscopy

  • Data analysis parameters:

    • Initial velocity of GTPase activity (nmol Pi/min/mg FtsZ)

    • Critical concentration for FtsZ polymerization (μM)

    • Binding affinity between YPO2196 and FtsZ (Kd value)

    • Polymer stability half-life (min)

These combined approaches provide a comprehensive assessment of YPO2196's role in bacterial septation.

What are the challenges in resolving the crystal structure of YPO2196 and how can they be addressed?

Crystallizing membrane-associated proteins like YPO2196 presents several significant challenges. These challenges and their methodological solutions include:

  • Protein solubility issues:

    • Generate truncated constructs lacking hydrophobic regions

    • Create fusion proteins with highly soluble partners (MBP, SUMO)

    • Screen detergents systematically (DDM, LDAO, CHAPS) for membrane-associated domains

  • Conformational heterogeneity:

    • Add ligands or binding partners to stabilize specific conformations

    • Employ surface entropy reduction (SER) through mutation of surface lysine/glutamate clusters to alanine

    • Use computational prediction tools (XtalPred, SVMCRYS) to guide construct design

  • Crystal packing challenges:

    • Implement high-throughput crystallization screening (500+ conditions)

    • Utilize automated crystallization robots for nanoliter-scale drops

    • Explore crystallization with antibody fragments (Fab, nanobodies) to create additional crystal contacts

  • Data collection optimization:

    • Collect data at synchrotron radiation facilities for weak-diffracting crystals

    • Implement helical data collection for radiation-sensitive crystals

    • Consider micro-focused beams for small crystals

  • Alternative structural approaches:

    • Cryo-electron microscopy for protein complexes

    • NMR for structural determination of domains under 25 kDa

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

This multi-faceted approach has successfully addressed similar challenges in structurally related bacterial division proteins.

How should experimental controls be designed when studying YPO2196 interaction with other septation proteins?

Robust control design is critical when investigating YPO2196 interactions with other septation proteins. A comprehensive control strategy includes:

  • Negative controls:

    • Non-interacting proteins of similar size/charge (BSA or lysozyme)

    • Heat-denatured YPO2196 to confirm specificity

    • Buffer-only conditions to establish baseline signals

  • Positive controls:

    • Known interaction partners in the septation pathway

    • Artificially created fusion constructs with known binding properties

    • Commercial protein interaction standards

  • Specificity controls:

    • Competition assays with unlabeled proteins

    • Concentration gradients to establish dose-dependency

    • Mutation of predicted interaction interfaces

  • Technical controls:

    • Reverse tag configurations (swap bait and prey)

    • Multiple detection methods (pull-down, SPR, FRET, Y2H)

    • Independent experimental replicates performed by different researchers

  • In vivo validation:

    • Co-localization studies in bacterial cells

    • Genetic complementation assays

    • Synthetic lethality screens

This layered control strategy ensures that observed interactions represent genuine biological phenomena rather than experimental artifacts.

What considerations are important when designing site-directed mutagenesis experiments for YPO2196?

Site-directed mutagenesis of YPO2196 requires careful planning to yield meaningful functional insights. Key methodological considerations include:

  • Target selection rationale:

    • Conserved residues based on multiple sequence alignments across bacterial species

    • Residues in predicted functional domains or motifs

    • Surface-exposed residues for potential interaction interfaces

    • Hydrophobic core residues for stability studies

  • Mutation strategy:

    • Conservative substitutions (e.g., D→E, K→R) to preserve charge but alter size

    • Non-conservative substitutions (e.g., D→A) to eliminate specific properties

    • Cysteine scanning for accessibility studies

    • Sequential alanine scanning of potential functional regions

  • Technical implementation:

    • Overlap extension PCR for standard mutagenesis

    • QuikChange protocols for simple substitutions

    • Gibson Assembly for multiple simultaneous mutations

    • CRISPR-based approaches for chromosomal mutations

  • Validation methods:

    • DNA sequencing to confirm mutations (both strands)

    • Expression testing to ensure protein stability

    • Circular dichroism to confirm proper folding

    • Thermal shift assays to assess structural integrity

  • Functional assessment:

    • Comparative biochemical assays with wild-type protein

    • In vivo complementation studies

    • Interaction studies with known binding partners

    • Localization studies in bacterial cells

This systematic approach ensures that mutagenesis experiments yield interpretable results about structure-function relationships in YPO2196.

How can contradictory results between in vitro and in vivo studies of YPO2196 function be reconciled?

Reconciling contradictory results between in vitro and in vivo studies of YPO2196 requires systematic analysis and additional experimental approaches:

  • Systematic analysis of differences:

    • Create a comprehensive comparison table of experimental conditions

    • Identify key variables differing between systems (protein concentration, buffer composition, presence of other cellular factors)

    • Assess temporal aspects of experiments (equilibrium vs. kinetic measurements)

  • Bridging experimental approaches:

    • Employ reconstituted systems of increasing complexity

    • Perform in vitro experiments with cell extracts or membrane fractions

    • Use permeabilized cells for semi-in vivo experiments

    • Develop bacterial spheroplast assays

  • Computational modeling:

    • Develop models incorporating rate constants from in vitro experiments

    • Simulate cellular conditions with appropriate concentration constraints

    • Account for macromolecular crowding effects in simulations

    • Test multi-scale models bridging molecular and cellular levels

  • Advanced microscopy techniques:

    • Single-molecule tracking in live cells

    • Fluorescence correlation spectroscopy for in vivo binding kinetics

    • FRET-based sensors for conformation changes

    • Super-resolution microscopy to track septation dynamics

  • Integration strategy:

    • Develop testable hypotheses explaining discrepancies

    • Design experiments specifically targeting these hypotheses

    • Consider regulatory mechanisms present in vivo but absent in vitro

    • Evaluate post-translational modifications affecting function

This systematic approach helps develop a unified model that reconciles apparently contradictory observations across experimental systems.

What statistical methods are most appropriate for analyzing protein-protein interaction data involving YPO2196?

The statistical analysis of protein-protein interaction data for YPO2196 requires techniques appropriate to the experimental methodology employed:

Interaction MethodRecommended Statistical ApproachKey ParametersThreshold for Significance
Pull-down/Co-IPFold enrichment over background, Student's t-testp-value, fold changep < 0.05, fold change > 2.0
Yeast Two-HybridChi-square test, Fisher's exact testp-value, odds ratiop < 0.01, growth on selective media
Surface Plasmon ResonanceNon-linear regression (one-site binding)Kd, kon, koff, χ² valueR² > 0.95, χ² < 3.0
Isothermal Titration CalorimetryMaximum likelihood estimationΔH, ΔS, Kd, N (stoichiometry)ΔG < 0, Kd < 10 μM
FRETPaired t-test, ANOVA for multiple conditionsFRET efficiency, p-valuep < 0.05, efficiency > 5%
Cross-linking Mass SpectrometryPoisson distribution, false discovery rateSpectral counts, FDRFDR < 0.05, >2 unique peptides

For integrating results across multiple experimental approaches:

  • Use weighted scoring systems that account for the false positive/negative rates of each method

  • Apply Bayesian networks to integrate diverse data types

  • Implement machine learning approaches for complex datasets

  • Conduct meta-analysis when multiple replicates or studies are available

  • Consider principal component analysis to identify patterns across multiple interaction partners

What are the most promising research directions for understanding YPO2196's role in bacterial septation?

The most promising research directions for further understanding YPO2196's role in bacterial septation encompass several methodological approaches:

  • Interactome mapping:

    • Comprehensive protein-protein interaction studies using proximity labeling techniques (BioID, APEX)

    • Temporal analysis of interaction dynamics throughout the cell cycle

    • Cross-species comparative analysis to identify conserved interaction partners

  • High-resolution structural studies:

    • Cryo-electron microscopy of YPO2196 in complex with other septation proteins

    • Integrative structural biology combining X-ray crystallography, NMR, and computational modeling

    • Time-resolved structural studies to capture conformational changes during septation

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize septation protein localization with nanometer precision

    • Single-molecule tracking to monitor YPO2196 dynamics in living cells

    • Correlative light and electron microscopy to connect protein localization with ultrastructural features

  • Genetic and genomic approaches:

    • CRISPR interference for temporal control of YPO2196 expression

    • Suppressor mutation analysis to identify genetic interactions

    • Comparative genomics across bacterial species to identify functional conservation and specialization

  • Systems biology integration:

    • Quantitative modeling of the septation process incorporating YPO2196 function

    • Network analysis to position YPO2196 within the broader cell division regulatory network

    • Multi-omics approaches connecting transcriptome, proteome, and metabolome data

These research directions, pursued through collaborative interdisciplinary efforts, offer the greatest potential for comprehensive understanding of YPO2196's role in bacterial cell division mechanisms.

How might knowledge of YPO2196 function contribute to antimicrobial development strategies?

Understanding YPO2196 function has significant implications for antimicrobial development through several mechanistic pathways:

  • Target-based drug design:

    • Structure-based virtual screening against identified binding pockets

    • Fragment-based lead discovery targeting YPO2196 functional domains

    • Allosteric inhibitor development to disrupt protein-protein interactions

    • Peptidomimetic approaches based on natural binding partners

  • Assay development for high-throughput screening:

    • FRET-based interaction disruption assays

    • Activity-based biochemical screens

    • Phenotypic screens in bacterial reporter systems

    • Cell division morphology screens

  • Resistance mechanism prediction:

    • Identification of potential resistance mutations through directed evolution

    • Computational analysis of mutational tolerance

    • Cross-resistance profile assessment with existing antibiotics

    • Epistasis mapping to identify compensatory pathways

  • Combination therapy rationale:

    • Identification of synergistic targets in the septation pathway

    • Development of dual-targeting molecules

    • Sequential blocking of cell division steps

    • Sensitization strategies to enhance existing antibiotics

  • Specificity considerations:

    • Comparative analysis with human proteins to identify specificity determinants

    • Toxicity prediction based on off-target binding potential

    • Narrow vs. broad-spectrum inhibitor design strategies

    • Species-specific targeting approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.