Recombinant Probable intracellular septation protein A (YPTB2119)

Shipped with Ice Packs
In Stock

Description

Introduction to YPTB2119 and Intracellular Septation Proteins

Intracellular septation proteins are a specialized class of bacterial proteins that participate in cell division processes. YPTB2119, specifically identified in Yersinia pseudotuberculosis serotype I, is classified as a probable intracellular septation protein based on sequence homology and predicted function. This protein belongs to a broader family of septation proteins that facilitate the formation of septa during bacterial cell division. The study of these proteins has gained significance due to their potential role in bacterial pathogenicity and as possible targets for novel antimicrobial therapies. Septation processes are critical for bacterial survival and propagation, making them interesting subjects for both basic microbiological research and applied pharmacological investigations.

Research on related septation proteins in other bacterial species provides contextual background for understanding YPTB2119. For instance, the ispA gene in Shigella flexneri encodes an intracellular septation protein that has been demonstrated to be essential for virulence . Mutations in ispA result in defective cell division, leading to the formation of long filamentous bacteria lacking septa, ultimately hampering the bacterium's ability to spread through epithelial cell monolayers . These findings suggest that YPTB2119 might play similarly crucial roles in Yersinia pseudotuberculosis pathogenicity, though direct experimental evidence specific to YPTB2119 is still emerging.

Genomic Context and Classification

YPTB2119 is also known by the synonym yciB and is classified as an inner membrane-spanning protein . The gene encoding this protein has been sequenced and cataloged in protein databases with the UniProt ID Q66AL1 . The genomic organization and regulatory elements of YPTB2119 share similarities with other bacterial septation proteins, suggesting evolutionary conservation of these critical cellular components. The conservation of such proteins across different bacterial species underscores their fundamental importance in bacterial physiology and potentially in pathogenesis mechanisms.

Protein Structure and Domains

While detailed three-dimensional structural information for YPTB2119 is not fully elucidated, sequence analysis suggests the presence of transmembrane domains that anchor the protein within the bacterial inner membrane. The hydrophobic character of the protein indicates multiple membrane-spanning segments, which likely position the protein to participate in septation processes at the cytoplasmic membrane interface. These structural features are consistent with its classification as an inner membrane-spanning protein and its putative role in intracellular septation .

Expression Systems and Methodology

The recombinant YPTB2119 protein has been successfully expressed in Escherichia coli expression systems . The construct includes the full-length protein (amino acids 1-180) fused to an N-terminal His tag to facilitate purification and detection . The use of E. coli as an expression host offers several advantages, including high yield, scalability, and established protocols for membrane protein expression. The successful expression of this highly hydrophobic membrane protein demonstrates the feasibility of producing sufficient quantities for research and potential therapeutic applications.

Purification and Quality Assessment

The recombinant protein undergoes purification processes resulting in a preparation with greater than 90% purity as determined by SDS-PAGE analysis . The purified protein is typically supplied in lyophilized form, which enhances stability during storage and transportation. Quality control measures ensure consistent protein characteristics across production batches, providing researchers with reliable material for experimental investigations. The high purity level is essential for functional studies and potential applications in structural biology investigations.

Predicted Cellular Functions

While specific functional studies on YPTB2119 are still emerging, insights can be gained from research on homologous proteins such as ispA in Shigella flexneri. The ispA protein has been identified as essential for virulence, affecting several functions of the virulence process . Mutational analysis of ispA revealed that it plays critical roles in bacterial cell division, as mutants exhibited defects in septation leading to filamentous growth . By extension, YPTB2119 likely participates in similar cell division processes in Yersinia pseudotuberculosis, potentially contributing to the pathogen's virulence capabilities.

Potential Role in Bacterial Pathogenesis

Research on similar septation proteins suggests that YPTB2119 may be integral to Yersinia pseudotuberculosis pathogenicity. In Shigella, the ispA mutation affected not only cell division but also the bacterium's ability to polymerize actin, which is prerequisite for intra- and inter-cellular spreading . This dual impact on both septation and virulence-associated functions highlights the potential significance of septation proteins like YPTB2119 in bacterial pathogenesis. Studies in Shigella showed that ispA mutants initially spread intercellularly at rates comparable to wild-type bacteria but gradually slowed and ceased spreading due to progressive defects in cell division . These findings provide a framework for understanding how YPTB2119 might function in the pathophysiology of Yersinia infections.

Current Research Applications

The recombinant YPTB2119 protein serves as a valuable tool for various research applications. It enables studies investigating bacterial septation mechanisms, membrane protein dynamics, and potential antimicrobial target validation. The availability of purified recombinant protein facilitates biochemical assays, protein-protein interaction studies, and structural investigations. Additionally, it can be used to generate antibodies for immunodetection of native YPTB2119 in bacterial samples, supporting both basic research and diagnostic development.

Potential as an Antimicrobial Target

Given the essential role of septation proteins in bacterial viability and virulence, YPTB2119 represents a potential target for novel antimicrobial strategies. Research on ispA has demonstrated that disruption of this gene renders Shigella avirulent , suggesting that targeting similar proteins like YPTB2119 could effectively neutralize pathogenic bacteria. The continued characterization of YPTB2119 may contribute to the development of new therapeutic approaches aimed at combating Yersinia infections and potentially other bacterial pathogens with homologous septation proteins.

Reconstitution Guidelines

For optimal use in research applications, the lyophilized recombinant YPTB2119 protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Prior to opening, the vial should be briefly centrifuged to bring the contents to the bottom. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and to aliquot the solution to minimize freeze-thaw cycles . These handling procedures are designed to maintain protein integrity and activity for experimental applications.

Relation to IspA in Shigella flexneri

The ispA gene in Shigella flexneri encodes a protein with functional similarities to YPTB2119. Both are described as hydrophobic proteins involved in septation processes. Research has demonstrated that ispA is located between the trp and tonB genes in the Escherichia coli genome , providing clues about the genomic context of these septation proteins. Functional studies have shown that ispA is essential for Shigella virulence, as mutants lacking this gene exhibit defects in septation and intercellular spreading . These findings establish a valuable comparative framework for understanding the potential functions of YPTB2119 in Yersinia pseudotuberculosis.

Relationship to Other Septation Regulators

Broader research on septation processes in bacteria has identified various regulators that coordinate cell division. For instance, studies in other systems have identified proteins like MztA, described as a mitotic-spindle organizing protein that mediates septation . While the direct relationship between YPTB2119 and these other septation regulators remains to be fully characterized, the collective research on septation proteins provides valuable context for understanding the complex molecular networks governing bacterial cell division.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yciB; YPTB2119; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
YPTB2119
Target Protein Sequence
MKQLLDFLPLVVFFIFYKMYDIFVASGALIVATLVALAFTWLKYRKVEKMTLVTAAMVLV FGTLTLAFHSDLFIKWKVTVLYVLFALALLVSQWVMKKPLIQRMLGKELTLPDKVWSTLN LSWAIFFLVCGLLNIYVAFWLPQDIWVNFKVFGLTALTLIFTLISGVYIYRHMPEEQKKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: ypo:BZ17_342

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for YPTB2119 recombinant protein?

For optimal protein stability and activity maintenance, YPTB2119 should be stored at -20°C or -80°C upon receipt. Proper storage methodology significantly impacts experimental reproducibility and protein functionality. The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

For working solutions, aliquoting is essential to prevent repeated freeze-thaw cycles that can lead to protein degradation. Working aliquots can be stored at 4°C for up to one week. For long-term storage, it is recommended to add glycerol (final concentration of 30-50%) before storing at -20°C/-80°C. This cryoprotectant approach helps preserve protein structure and function during extended storage periods .

How should YPTB2119 be reconstituted for experimental use?

Methodologically, YPTB2119 reconstitution requires careful attention to maintain protein integrity. The recommended protocol involves:

  • Brief centrifugation of the vial before opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (recommended final concentration: 50%) for stability

  • Gentle mixing by inversion rather than vortexing to prevent protein denaturation

This approach minimizes protein aggregation and maximizes downstream experimental utility. After reconstitution, the solution should be clear without visible particulates. If particulates are observed, gentle warming at room temperature with periodic inversion may help solubilize the protein .

What experimental controls should be included when studying YPTB2119 function?

Rigorous experimental design for YPTB2119 functional studies requires multiple controls to ensure valid interpretations. A comprehensive control strategy includes:

Control TypeDescriptionPurpose
Negative ControlBuffer-only or irrelevant protein with similar tagEstablishes baseline and detects non-specific effects
Positive ControlKnown functional protein from similar familyValidates assay performance
Tag-only ControlExpression vector producing only the His-tag portionDistinguishes tag-mediated from protein-specific effects
Heat-inactivated YPTB2119Protein denatured by heating (95°C, 10 min)Confirms activity is dependent on protein structure
Dose-responseMultiple concentrations of YPTB2119Establishes relationship between protein quantity and observed effect

This systematic approach to experimental controls aligns with best practices in protein function characterization and helps identify potential confounding variables . The selection of specific controls should be tailored to the particular experimental question being addressed, with attention to controlling both extraneous and confounding variables.

How can researchers distinguish between YPTB2119 from Yersinia pseudotuberculosis and homologous proteins from other Yersinia species?

Distinguishing YPTB2119 from its homologs requires a multi-faceted methodological approach. Sequence alignment analysis reveals high conservation between YPTB2119 from Y. pseudotuberculosis and its homolog YPO2196 (y2040, YP_1995) from Y. pestis, with identical amino acid sequences . This homology complicates species-specific studies but can be addressed through:

  • Use of species-specific antibodies targeting subtle structural differences

  • Mass spectrometry analysis focusing on post-translational modifications that may differ between species

  • Functional assays exploiting potential differences in binding partners or activity

  • Expression analysis in native contexts to identify regulatory differences

When designing experiments involving cross-species comparisons, researchers should incorporate careful validation steps to confirm protein identity and origin. This may include western blotting with species-specific antibodies, recombinant expression with species-specific tags, or genomic verification methods .

What analytical techniques are most effective for studying YPTB2119 membrane integration and topology?

YPTB2119's sequence analysis suggests multiple transmembrane domains, indicating it functions as an integral membrane protein. To elucidate its membrane topology and integration mechanisms, several complementary analytical approaches are recommended:

  • Biochemical fractionation: Sequential membrane extraction with increasingly stringent detergents can distinguish peripheral from integral membrane proteins.

  • Protease protection assays: Limited proteolysis of intact membrane vesicles compared to permeabilized membranes identifies exposed regions.

  • Site-directed fluorescence labeling: Strategic introduction of fluorescent probes at predicted loop regions can map topology when combined with accessibility studies.

  • Cryo-electron microscopy: For high-resolution structural analysis of membrane-embedded conformations.

  • Molecular dynamics simulations: Computational prediction of membrane interactions based on amino acid sequence and hydrophobicity profiles.

These methodologies provide complementary data on how YPTB2119 integrates into bacterial membranes, crucial for understanding its biological function and potential as a therapeutic target .

How should researchers design experiments to investigate YPTB2119's role in bacterial septation?

Investigating YPTB2119's role in bacterial septation requires a multi-dimensional experimental design approach that isolates its specific contributions. A comprehensive experimental strategy should include:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 mediated deletion or RNA interference techniques

    • Complementation with wild-type and mutant variants to confirm specificity

    • Phenotypic characterization focusing on cell division abnormalities

  • Localization studies:

    • Fluorescent protein fusions (ensuring tag doesn't disrupt function)

    • Immunofluorescence microscopy during different cell division stages

    • Co-localization with known septation markers

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Bacterial two-hybrid assays for protein-protein interactions

    • Cross-linking studies in native membrane environments

  • Conditional expression systems:

    • Inducible promoters to control timing and level of expression

    • Temperature-sensitive mutants to study dynamic processes

    • Cell-cycle synchronized cultures to examine temporal aspects

This systematic approach isolates variables and establishes causality between YPTB2119 activity and septation phenotypes. Controls must include isogenic strains differing only in YPTB2119 status to minimize confounding variables .

What are the methodological considerations for purifying functional YPTB2119 for in vitro studies?

Purifying membrane proteins like YPTB2119 while maintaining native functionality presents significant technical challenges. A methodical purification protocol should address:

  • Solubilization optimization:

    • Testing multiple detergent types (mild non-ionic, zwitterionic, etc.)

    • Detergent concentration screening to balance extraction efficiency and protein stability

    • Buffer composition adjustments (pH, salt concentration, stabilizing additives)

  • Affinity purification strategy:

    • Leveraging the N-terminal His-tag for IMAC (Immobilized Metal Affinity Chromatography)

    • Gentle elution conditions (imidazole gradient rather than step elution)

    • On-column detergent exchange if necessary

  • Post-purification handling:

    • Immediate buffer exchange to remove high imidazole concentrations

    • Addition of stabilizers (glycerol, specific lipids, reducing agents)

    • Concentration methods minimizing protein aggregation

  • Functional validation:

    • Activity assays specific to septation proteins

    • Circular dichroism to confirm secondary structure integrity

    • Size-exclusion chromatography to verify oligomeric state

Each step requires empirical optimization, as membrane proteins often exhibit detergent-specific behavior. Success typically requires iterative refinement of conditions to balance yield with functional integrity .

How can researchers effectively design control experiments to validate YPTB2119 antibody specificity?

Antibody specificity validation is critical for accurate interpretation of YPTB2119 localization and interaction studies. A comprehensive validation strategy should include:

  • Western blot controls:

    • Wild-type samples (positive control)

    • YPTB2119 knockout/knockdown samples (negative control)

    • Recombinant YPTB2119 at known concentrations (standard curve)

    • Closely related homologs (cross-reactivity assessment)

    • Pre-absorption with recombinant antigen (specificity control)

  • Immunofluorescence validation:

    • Parallel staining of wild-type and knockout cells

    • Competition with excess soluble antigen

    • Secondary antibody-only controls

    • Testing with known subcellular markers

  • Additional specificity tests:

    • Testing multiple antibody lots for consistency

    • Epitope mapping to confirm binding site

    • Mass spectrometry verification of immunoprecipitated proteins

These methodical approaches ensure that observed signals genuinely represent YPTB2119 rather than non-specific interactions or cross-reactivity with similar proteins. Particularly important is testing against the Y. pestis homolog (YPO2196) given their identical amino acid sequences .

How should researchers interpret conflicting data regarding YPTB2119 localization patterns?

Conflicting localization data for YPTB2119 requires systematic troubleshooting and critical evaluation of methodological differences. When faced with discrepant results, researchers should:

  • Evaluate fixation methods:

    • Compare chemical fixatives (paraformaldehyde, glutaraldehyde) versus cryo-fixation

    • Assess potential artifacts introduced by specific fixation protocols

    • Consider live-cell imaging alternatives to validate fixation-based observations

  • Compare tagging strategies:

    • N-terminal versus C-terminal tags may differentially affect localization

    • Fluorescent protein tags versus epitope tags might have varying impacts

    • Native-level versus overexpression can reveal different patterns

  • Analyze growth conditions:

    • Cell cycle stage influences septation protein localization

    • Media composition and growth phase affect membrane protein distribution

    • Stress conditions may trigger relocalization events

  • Statistical approaches:

    • Quantitative image analysis of multiple cells (n>100)

    • Cell-to-cell variation assessment

    • Correlation with cell size, division stage, and other parameters

What statistical approaches are most appropriate for analyzing YPTB2119 mutant phenotypes?

Statistical analysis of YPTB2119 mutant phenotypes requires careful consideration of experimental design and data characteristics. Recommended analytical approaches include:

Phenotype TypeRecommended Statistical MethodJustification
Growth rateRepeated measures ANOVAAccounts for time-series data structure
Cell morphologyChi-square test for categorical dataHandles distribution of morphological classes
Protein-protein interactionsMultiple hypothesis correction (e.g., Benjamini-Hochberg)Controls false discovery rate in large datasets
Localization patternsSpatial statistics (Ripley's K function)Quantifies non-random distribution patterns
Membrane integrationBootstrapping confidence intervalsRobust to non-normal distributions

Key considerations for rigorous statistical analysis include:

  • Power analysis prior to experimentation to determine adequate sample sizes

  • Appropriate randomization and blinding procedures to minimize bias

  • Testing for normality and homogeneity of variance before applying parametric tests

  • Using non-parametric alternatives when assumptions are violated

  • Reporting effect sizes alongside p-values to gauge biological significance

These statistical methodologies enhance reproducibility and allow meaningful comparisons between wild-type and mutant phenotypes, particularly when subtle or variable effects are expected .

How can researchers reconcile in vitro and in vivo findings about YPTB2119 function?

Discrepancies between in vitro and in vivo findings about YPTB2119 function are common and require systematic reconciliation strategies. When findings diverge across experimental systems, consider:

  • Context-dependent factors:

    • In vivo compensatory mechanisms may mask phenotypes seen in vitro

    • Microenvironment differences (pH, ionic strength, molecular crowding)

    • Presence of interacting partners in native systems

    • Post-translational modifications present in vivo but absent in vitro

  • Methodological reconciliation:

    • Development of reconstituted systems of increasing complexity

    • Ex vivo approaches that bridge the in vitro-in vivo divide

    • Correlation analysis between biochemical activities and physiological outcomes

    • Genetic complementation with biochemically characterized variants

  • Integrative data modeling:

    • Systems biology approaches to contextualize isolated findings

    • Mathematical modeling to predict how biochemical parameters translate to cellular phenotypes

    • Network analysis to position YPTB2119 within broader cellular processes

What are the most promising future research directions for YPTB2119?

Based on current knowledge gaps and technological capabilities, several high-priority research directions for YPTB2119 emerge:

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography studies of the full-length protein

    • Structure-function analyses through systematic mutagenesis

    • Computational modeling of membrane interactions and dynamics

  • Infection model studies:

    • Role in Yersinia pathogenesis and host-pathogen interactions

    • Comparative analysis across Yersinia species in different host environments

    • Potential as an antimicrobial target given its role in bacterial division

  • System-level integration:

    • Proteomic identification of the complete YPTB2119 interactome

    • Transcriptomic analysis of regulatory networks involving YPTB2119

    • Metabolomic impacts of YPTB2119 disruption

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize septation dynamics

    • Single-molecule tracking to assess protein mobility and clustering

    • Correlative light and electron microscopy for contextual ultrastructure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.