Recombinant Probable long-chain-fatty-acid--CoA ligase FadD23 (fadD23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-584
Protein Length
full length protein
Target Names
fadD23
Target Protein Sequence
MVSLSIPSMLRQCVNLHPDGTAFTYIDYERDSEGISESLTWSQVYRRTLNVAAEVRRHAA IGDRAVILAPQGLDYIVAFLGALQAGLIAVPLSAPLGGASDERVDAVVRDAKPNVVLTTS AIMGDVVPRVTPPPGIASPPTVAVDQLDLDSPIRSNIVDDSLQTTAYLQYTSGSTRTPAG VMITYKNILANFQQMISAYFADTGAVPPLDLFIMSWLPFYHDMGLVLGVCAPIIVGCGAV LTSPVAFLQRPARWLQLMAREGQAFSAAPNFAFELTAAKAIDDDLAGLDLGRIKTILCGS ERVHPATLKRFVDRFSRFNLREFAIRPAYGLAEATVYVATSQAGQPPEIRYFEPHELSAG QAKPCATGAGTALVSYPLPQSPIVRIVDPNTNTECPPGTIGEIWVHGDNVAGGYWEKPDE TERTFGGALVAPSAGTPVGPWLRTGDSGFVSEDKFFIIGRIKDLLIVYGRNHSPDDIEAT IQEITRGRCAAIAVPSNGVEKLVAIVELNNRGNLDTERLSFVTREVTSAISTSHGLSVSD LVLVAPGSIPITTSGKVRRAECVKLYRHNEFTRLDAKPLQASDL
Uniprot No.

Q&A

What is FadD23 and what is its role in Mycobacterium tuberculosis?

FadD23 is a long-chain fatty acyl-CoA ligase (FAAL) involved in the synthesis of Sulfolipid-1 (SL-1), a component located in the Mycobacterium tuberculosis cell wall. SL-1 is essential for pathogen virulence and intracellular growth, making FadD23 a potential drug target. FadD23 functions specifically within the SL-1 biosynthetic pathway alongside other enzymes including Pks2, PapA1, and MmpL8. Understanding its role is critical as it represents one of several proteins in this pathway that can be targeted for TB drug development.

How does FadD23 differ from other FadD proteins in Mycobacterium tuberculosis?

FadD23 belongs to the fatty acyl-CoA ligase family but functions specifically as a fatty acyl-AMP ligase (FAAL). While it shares significant sequence similarity with other FadD proteins (66% sequence similarity with FadD28), it has distinct substrate specificity and functional roles. The protein contains characteristic motifs including a 27-amino acid signature/FACS motif responsible for fatty acid binding and a linker (L) motif with the consensus sequence "Asp-Arg-Xaa-Lys" which is typical of long-chain FACSs. These specific structural features distinguish FadD23 from other members of the FadD family and contribute to its specialized function in SL-1 biosynthesis.

What is the domain organization of FadD23?

Full-length FadD23 consists of two distinct domains: a large N-terminal domain comprising residues 4-460 and a smaller C-terminal domain comprising residues 473-576. These domains are connected by flexible loops and an antiparallel β-sheet comprising residues 465-472. This bimodal structure is crucial for the protein's function, as the N-terminal domain alone cannot efficiently bind palmitic acid without the C-terminal domain's facilitation. The domain organization allows for the conformational changes necessary for the enzyme's catalytic activity.

Which experimental techniques are commonly used to study FadD23?

Multiple complementary techniques are employed to study FadD23. X-ray crystallography has been used to determine its three-dimensional structure, with data typically collected at synchrotron radiation facilities (such as SSRF) at 100K. Differential scanning fluorimetry (DSF) assays are used to characterize binding affinities and protein stability, often using SYPRO Orange as a fluorescent dye. Surface plasmon resonance (SPR) provides insights into protein-ligand interactions, with FadD23 typically immobilized on a sensor chip and fatty acids injected at varying concentrations. Enzymatic activity is assessed through hydroxamate-MesG assays. Molecular replacement using programs like Phaser, followed by refinement with Coot and Phenix, is employed for structural determinations.

What structural insights have been gained from FadD23-ligand complexes?

Crystal structures of FadD23 bound to various ligands have provided significant insights into its function. Structures of FadD23 bound to ATP or hexadecanoyl adenylate have been solved, revealing key interactions at the active site. More recently, the structure of FadD23 in complex with PhU-AMS (a non-hydrolyzable analog of acyl-AMP) has been determined at 2.64 Å resolution. These structures show that while PhU-AMS does not inhibit the adenylation activity of FadD23, it does improve the main Tm value in differential scanning fluorimetry assays, suggesting it may block the loading of the acyl chain onto Pks2. Structural comparisons between FadD23-PhU-AMS and other complexes like FadD32-PhU-AMS provide valuable information for structure-based design of both specific inhibitors of FadD23 and general inhibitors of fatty acyl-AMP ligases (FAALs).

How do mutations in the active site affect FadD23 enzymatic activity?

Mutations at the active site of FadD23 have been shown to significantly influence its enzymatic activity. Site-directed mutagenesis studies have identified key residues involved in substrate binding and catalysis. These mutations can affect various aspects of FadD23 function, including substrate specificity, catalytic efficiency, and thermal stability. The effect of these mutations provides insights into the catalytic mechanism and can guide the design of inhibitors targeting specific residues or regions of the protein. The structural and biochemical characterization of these mutants has been crucial for understanding the structure-function relationships in FadD23.

What is the relationship between FadD23 and antimicrobial resistance in Mycobacterium tuberculosis?

While direct links between FadD23 and antimicrobial resistance mechanisms are not extensively documented in the provided search results, the involvement of FadD23 in SL-1 biosynthesis connects it to bacterial virulence and persistence. Related fatty acid metabolism enzymes like FadD2 have been implicated in intrinsic pyrazinamide (PZA) resistance, suggesting that fatty acid metabolism pathways might broadly influence drug susceptibility in M. tuberculosis. Loss of function of the long-chain fatty acyl-CoA ligase FadD2 substantially enhances PZA and POA susceptibility in vitro, suggesting that targeting functions related to fatty acid metabolism has the potential to improve antitubercular activity. By extension, understanding FadD23's role in these networks could provide insights into resistance mechanisms and potential combination therapies.

What expression systems are optimal for producing recombinant FadD23?

Based on the research methodologies described, recombinant FadD23 is typically produced using bacterial expression systems, particularly E. coli. The protein is often expressed with affinity tags to facilitate purification. According to the search results, recombinant MtFadD5 (a related protein) has an additional 16 amino acids with a total calculated molecular mass of ~62 kDa, suggesting similar approaches might be used for FadD23. Expression optimization typically involves adjusting temperature, induction conditions, and media composition to maximize protein yield while maintaining proper folding. Following expression, purification typically involves affinity chromatography, possibly followed by size exclusion chromatography to obtain homogeneous protein for structural and functional studies.

What crystallization conditions have proven successful for FadD23?

Several crystallization conditions have been reported for obtaining diffraction-quality FadD23 crystals. For FadD23-palmitic acid co-crystals, a successful condition involved mixing the protein solution (10 mg/ml FadD23, 1 mM palmitic acid, and 1 mM ATP) with a well solution containing 140 mM sodium citrate tribasic dihydrate, 60 mM magnesium chloride hexahydrate, 30 mM tris hydrochloride (pH 8.5), 14% (w/v) polyethylene glycol 3,350, and 9% (w/v) polyethylene glycol 4,000. For the AMP-PNP-FadD23 complex, suitable crystals were obtained in 70 mM Tris (pH 8.5), 140 mM sodium citrate tribasic dihydrate, 140 mM ammonium phosphate monobasic, 35% w/v (+/−)-2-methyl-2,4-pentanediol, and 14% (w/v) polyethylene glycol 3,350. The FadD23 N-terminal domain was crystallized in 70 mM Bis-Tris pH 6.5, 60 mM sodium chloride, 20% (w/v) polyethylene glycol 3,350, and 6% (w/v) polyethylene glycol 6,000.

How can binding affinities between FadD23 and potential inhibitors be accurately measured?

Multiple biophysical techniques are employed to measure binding affinities between FadD23 and potential inhibitors. Differential scanning fluorimetry (DSF) has proven valuable for initial screening, as it can detect shifts in the protein's thermal melting temperature (Tm) upon ligand binding. In a typical DSF assay for FadD23, the reaction mixture contains protein (typically 5-10 μM), a fluorescent dye like SYPRO Orange, the potential inhibitor (1-2 mM), and sometimes cofactors like MgCl2 and ATP, with fluorescence measured during a temperature gradient of 1°C/min. Surface plasmon resonance (SPR) provides more quantitative binding data, with FadD23 typically immobilized on a CM5 sensor chip and compounds injected at concentrations ranging from micromolar to millimolar. For direct activity assessment, hydroxamate-MesG assays can measure the inhibitory effect of compounds on FadD23's enzymatic function. These complementary approaches provide a comprehensive assessment of inhibitor binding and efficacy.

What are the best methods for assessing FadD23 enzymatic activity?

The hydroxamate-MesG assay has been successfully used to assess FadD23 enzymatic activity. This assay measures the adenylation activity of FadD23, which is the first step in its catalytic mechanism. The assay can be used to test the inhibitory effects of potential drug candidates, as demonstrated in studies with PhU-AMS. Additionally, coupled enzymatic assays that monitor ATP consumption or AMP production can be employed to measure FadD23 activity. For studying the complete reaction cycle, including the transfer of the acyl group to the downstream acceptor, more complex assays involving the partner protein Pks2 may be necessary. These activity assays are crucial for understanding the enzyme's function and for screening potential inhibitors.

How do the structural features of FadD23 inform inhibitor design strategies?

The crystal structures of FadD23 bound to various ligands provide critical information for structure-based inhibitor design. The detailed understanding of the binding modes of ATP, hexadecanoyl adenylate, and analogs like PhU-AMS reveals key interaction sites that can be exploited for inhibitor development. The structure of the FadD23-PhU-AMS complex, determined at 2.64 Å resolution, is particularly valuable for designing both specific inhibitors of FadD23 and general inhibitors of fatty acyl-AMP ligases (FAALs). Structural comparisons with related enzymes like FadD32 and FadD28 can guide the development of selective inhibitors. The identification of the active site residues and their roles in catalysis further informs rational drug design approaches targeting FadD23.

What are the most promising inhibitor scaffolds identified for FadD23?

While specific inhibitors designed exclusively for FadD23 are still in development, research has explored several promising scaffolds. Non-hydrolyzable analogs of acyl-AMP, such as PhU-AMS (11-phenoxyundecanoyl-AMS), have been investigated. Although PhU-AMS did not inhibit the adenylation activity of FadD23, it did improve the protein's thermal stability, suggesting it might block the loading of the acyl chain onto the downstream partner Pks2. This provides a foundation for designing modified analogs with improved inhibitory properties. Related compounds have shown inhibitory effects on other FAALs, such as FadD32 and FadD28, suggesting that optimized versions might be effective against FadD23. The structural similarities and differences between these enzymes can guide the development of both selective and broad-spectrum inhibitors targeting multiple FAALs in the SL-1 biosynthetic pathway.

How can high-throughput screening methods be optimized for FadD23 inhibitor discovery?

Differential scanning fluorimetry (DSF) assays have been identified as potentially highly suitable high-throughput methods for inhibitor screening of FadD23 and other FAALs. In studies with FadD23, a correlation was observed between changes in thermal melting temperature (Tm) and inhibition potential, suggesting that DSF could serve as a preliminary screening tool. A typical DSF screening assay would include purified FadD23, a fluorescent dye like SYPRO Orange, and a library of potential inhibitors in a 96-well or 384-well format. Hits from the DSF screen can then be validated using more direct activity assays like the hydroxamate-MesG assay. Virtual screening based on the crystal structures of FadD23 complexes can complement experimental approaches by identifying compounds predicted to bind at the active site or interfere with the protein's interaction with downstream partners like Pks2.

What is the potential for targeting multiple enzymes in the SL-1 biosynthetic pathway?

The SL-1 biosynthetic pathway involves multiple enzymes, including FadD23, Pks2, PapA1, and MmpL8, all of which represent potential drug targets. This provides an opportunity for combination approaches targeting multiple steps in the pathway. Inhibitors that disrupt the interaction between FadD23 and its downstream partner Pks2 could be particularly effective, as suggested by studies with PhU-AMS, which may block the loading of the acyl chain onto Pks2. Understanding the structural and functional relationships between these enzymes can guide the development of inhibitors targeting protein-protein interactions or multiple catalytic activities. This multi-target approach could potentially overcome resistance mechanisms and enhance the efficacy of anti-tuberculosis therapies.

Key Structural Parameters of FadD23

ParameterValueMethodReference
Crystal structure resolution2.64 ÅX-ray crystallography
N-terminal domainResidues 4-460Structural analysis
C-terminal domainResidues 473-576Structural analysis
Domain linkerResidues 465-472Structural analysis
Main Tm values48°C and 60°CDifferential scanning fluorimetry
Tm with PhU-AMS60°CDifferential scanning fluorimetry
Tm with ATP62°CDifferential scanning fluorimetry

FadD23 Sequence Conservation and Motifs

MotifSequence/LocationFunctionHomology
Signature/FACS motif27 amino acids longFatty acid bindingConserved in FadD family
Linker (L) motif"Asp-Arg-Xaa-Lys"Mediates conformational changesCharacteristic of long-chain FACSs
Sequence similarity to FadD2866%-Share same evolutionary branch
Conserved motifsA1 to A10Various catalytic functionsPresent in FadD homologs

What are the critical knowledge gaps in understanding FadD23 function?

Despite significant progress in characterizing FadD23, several knowledge gaps remain. The precise mechanism of acyl transfer from FadD23 to its downstream partner Pks2 requires further investigation. While we understand that the C-terminal domain is critical for FadD23 function, the exact conformational changes during the catalytic cycle are not fully elucidated. Additionally, the regulatory mechanisms controlling FadD23 expression and activity in vivo under different conditions remain to be explored. Understanding these aspects would provide a more complete picture of FadD23's role in SL-1 biosynthesis and potentially reveal new strategies for disrupting this pathway.

How might FadD23 research contribute to development of novel tuberculosis therapies?

FadD23 research holds significant promise for tuberculosis drug development. As a key enzyme in the SL-1 biosynthetic pathway, FadD23 represents a valid target for developing new anti-TB drugs. The detailed structural information now available for FadD23 provides a foundation for structure-based drug design approaches. Compounds that inhibit FadD23 or disrupt its interaction with Pks2 could potentially reduce M. tuberculosis virulence and persistence. Moreover, understanding the relationships between different fatty acid metabolism pathways, including those involving FadD23 and other FadD proteins, could guide the development of combination therapies targeting multiple aspects of mycobacterial metabolism. This could potentially enhance the efficacy of existing drugs like pyrazinamide, as suggested by studies showing that disruption of fatty acid metabolism functions can dramatically improve antitubercular activity.

What technical advances would facilitate deeper understanding of FadD23 and related enzymes?

Several technical advances would enhance our understanding of FadD23 and related enzymes. Development of improved expression systems for producing larger quantities of properly folded FadD23 would facilitate structural and biochemical studies. Cryo-electron microscopy could provide insights into the conformational dynamics of FadD23 during its catalytic cycle, complementing the static snapshots provided by X-ray crystallography. Advanced computational approaches, including molecular dynamics simulations, could model the conformational changes and interactions between FadD23 and its substrates or partner proteins. Development of more sensitive and high-throughput assays for measuring FadD23 activity and inhibition would accelerate drug discovery efforts. Additionally, techniques for studying FadD23 function in the context of living mycobacterial cells would bridge the gap between in vitro biochemical studies and in vivo efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.