Recombinant Probable membrane protein Rv1733c/MT1774 (Rv1733c, MT1774)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Probable Membrane Protein Rv1733c/MT1774

The Recombinant Probable Membrane Protein Rv1733c/MT1774, commonly referred to as Rv1733c, is a protein derived from Mycobacterium tuberculosis, a bacterium responsible for tuberculosis (TB). This protein is of significant interest due to its potential role in diagnosing and managing TB infections, particularly in distinguishing between active TB (ATB) and latent TB infection (LTBI).

Characteristics of Rv1733c

Rv1733c is a probable conserved transmembrane protein with a length of 210 amino acids. It is encoded by the gene Rv1733c in the Mycobacterium tuberculosis H37Rv strain . The protein shows similarity to hypothetical proteins from other bacteria, such as Streptomyces coelicolor, indicating a possible conserved function across different species .

Role in Tuberculosis Diagnosis

Rv1733c has been identified as a latency-associated antigen, which means it is expressed during the latent phase of TB infection. This characteristic makes it useful for differentiating between ATB and LTBI. Studies have used Rv1733c and its synthetic long peptides (Rv1733c SLP) in FluoroSpot assays to detect specific T-cell responses, such as the secretion of interferon-γ (IFN-γ) and interleukin-2 (IL-2) .

Table 2: Diagnostic Performance of Rv1733c

Diagnostic ApproachSensitivitySpecificity
Rv1733c SLP72.2%73.7%
ESAT-6 & CFP-1082.5%66.7%
Combined Approach84.2%83.3%

Recombinant Protein Production

Recombinant Rv1733c protein is produced using various host systems, including E. coli, yeast, baculovirus, and mammalian cells. The purity of these proteins is typically greater than 85%, as determined by SDS-PAGE . These recombinant proteins are used in research applications such as Western blotting and ELISA.

Table 3: Recombinant Rv1733c Production Details

Host SystemPurityApplications
E. coli≥ 90%Western Blot, ELISA
Yeast≥ 85%Various research applications
Baculovirus≥ 85%Various research applications
Mammalian Cells≥ 85%Various research applications

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Target Names
Rv1733c, MT1774
Target Protein Sequence
MIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLEAVVMLLAVTVSLLTIPFA AAAGTAVQDSRSHVYAHQAQTRHPATATVIDHEGVIDSNTTATSAPPRTKITVPARWVVN GIERSGEVNAKPGTKSGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAG ALLALTRAILIRVRNASWQHDIDSLFCTQR
Uniprot No.

Q&A

What is Rv1733c and why is it significant in tuberculosis research?

Rv1733c is a latency-associated antigen from Mycobacterium tuberculosis (MTB), classified as a probable integral-membrane protein with promiscuous T-cell and B-cell epitopes. Its significance stems from its potential as a vaccine candidate against tuberculosis and its role in differentiating between active tuberculosis (ATB) and latent tuberculosis infection (LTBI). Rv1733c is particularly important because it is a hypoxia-related latent antigen that can induce different cytokine expression patterns in ATB and LTBI conditions, making it valuable for diagnostic applications . According to the MTB Network Portal, Rv1733c is a transmembrane protein with a length of 633 base pairs encoding 210 amino acids .

What are the structural and functional characteristics of Rv1733c?

Rv1733c is classified as a probable conserved transmembrane protein located at genome position 1959855-1960487 on the negative strand of the MTB genome. The protein has a total length of 210 amino acids and is predicted to be co-regulated in modules bicluster_0182 with residual 0.43 and bicluster_0417 with residual 0.42 . This regulation is possibly mediated by de-novo identified cis-regulatory motifs. Functionally, Rv1733c plays a role in MTB latency and has been shown to induce specific immune responses in hosts, particularly in LTBI subjects where it causes increased production of IFN-γ compared to ATB patients .

How does Rv1733c differ from other MTB antigens?

Unlike virulence factors such as ESAT-6 and CFP-10 which are primarily associated with active infection, Rv1733c is specifically a latency-associated antigen that shows differential recognition in latent versus active tuberculosis infections. Previous studies have demonstrated preferential recognition of Rv1733c by T cells in subjects with LTBI compared to those with ATB . This unique property makes Rv1733c valuable when used in combination with other antigens for diagnostic purposes. When combined with ESAT-6 and CFP-10 in FluoroSpot assays, Rv1733c SLP (synthetic long peptides derived from Rv1733c) significantly improves the accuracy of differential diagnosis between ATB and LTBI, increasing specificity from 66.7% to 83.3% .

What methodologies are most effective for expression and purification of recombinant Rv1733c?

The optimal expression of recombinant Rv1733c involves cloning the chemically synthesized rv1733c coding sequence into expression vectors such as pET-23a(+), followed by transformation into Escherichia coli BL21 (DE3) cells. For optimized expression, factorial design of experiments has been employed, evaluating four different media types, IPTG concentrations, and induction durations . The recombinant protein can be efficiently purified using His-tag purification kits and detected through western blotting. This approach allows for the production of sufficient quantities of purified Rv1733c for immunological studies and diagnostic test development.

During optimization, it's critical to monitor expression levels under different conditions, as membrane proteins like Rv1733c can present challenges in bacterial expression systems, potentially forming inclusion bodies that require specialized solubilization and refolding protocols to obtain functionally active protein.

How do synthetic long peptides derived from Rv1733c (Rv1733c SLP) compare to the whole protein in immunological assays?

Rv1733c SLP has demonstrated several advantages over the whole protein in immunological assays. Animal experiments have shown that Rv1733c SLP causes a stronger immune response and induces higher levels of IFN-γ production in mice compared to the whole Rv1733c protein . In the context of therapeutic vaccination, SLPs have proven to induce better responses and protection against tumors compared to short peptides .

The enhanced immunogenicity of Rv1733c SLP is particularly valuable in diagnostic applications. When using the frequency of single IL-2-secreting T cells stimulated by Rv1733c SLP as a diagnostic marker (with a cutoff value of 1 spot-forming cell per 2.5 × 10^5 peripheral blood mononuclear cells), the sensitivity and specificity for distinguishing ATB from LTBI were 72.2% and 73.7%, respectively . Furthermore, when Rv1733c SLP is used in combination with ESAT-6 and CFP-10 in FluoroSpot assays, the diagnostic accuracy significantly improves, with sensitivity and specificity reaching 84.2% and 83.3%, respectively .

What are the current challenges in using Rv1733c for tuberculosis diagnostics?

Despite its promising results, several challenges exist in using Rv1733c for tuberculosis diagnostics. Current diagnostic methods using Rv1733c SLP achieve sensitivities and specificities that, while improved, still leave room for enhancement to reach clinical diagnostic standards. The production of consistent, high-quality recombinant Rv1733c or synthetic peptides at scale remains technically challenging .

Additionally, there is a critical consideration for future diagnostic applications: if Rv1733c-based vaccines become widely used, the discriminatory ability of Rv1733c SLP for differential diagnosis between ATB and LTBI would be significantly compromised . This is because vaccination would induce Rv1733c-specific immune responses in healthy individuals, potentially leading to false-positive results in diagnostic tests that rely on detecting natural immune responses to this antigen.

Furthermore, standardization of assay conditions, interpretation criteria, and validation across diverse populations with varying tuberculosis epidemiology are necessary before Rv1733c-based diagnostics can be broadly implemented in clinical settings.

What is the optimal protocol for FluoroSpot assays using Rv1733c?

The optimal FluoroSpot assay protocol for Rv1733c involves isolating peripheral blood mononuclear cells (PBMCs) from subjects, followed by stimulation with either Rv1733c or Rv1733c SLP. Based on research findings, the following parameters have been established:

  • PBMC concentration: 2.5 × 10^5 cells per well

  • Detection focus: Single IL-2-secreting T cells and Single IFN-γ-secreting T cells

  • Cutoff value: For single IL-2-secreting T cells stimulated by Rv1733c SLP, 1 spot-forming cell (SFC) per 2.5 × 10^5 PBMCs

For maximum diagnostic accuracy, Rv1733c SLP should be used in combination with ESAT-6 and CFP-10 antigens. Statistical analysis is typically performed using software like SPSS with the Kolmogorov-Smirnov test adopted to examine variable data distribution. The ROC (Receiver Operating Characteristic) curve analysis is used to define the best cutoff values, and binary logistic regression models are employed for fitting joint diagnostic parameters .

The differential cytokine responses observed between ATB and LTBI groups are particularly informative, as summarized in the following table:

AntigensCytokinesATBLTBIStatisticsP value
Rv1733c SLPSingle-IL-20 (0–1)1 (0–4)480.0<0.001
Single-IFN-γ0 (0–1)0 (0–3)989.50.731
Total-IL-20 (0–1)2 (0–4)563.0<0.001
Total-IFN-γ0 (0–2)0 (0–3)940.50.430
Dual IFN-γ/IL-20 (0–0)0 (0–0)896.50.110
Rv1733cSingle-IL-20 (0–3)3 (0–6)687.00.004
Single-IFN-γ0 (0–0)0 (0–0)981.50.611
Total-IL-20 (0–3)3 (0–7)722.50.010

How should sample size be determined for clinical studies evaluating Rv1733c-based diagnostics?

For clinical studies evaluating Rv1733c-based diagnostics, sample size determination should follow statistical principles appropriate for diagnostic test evaluation. Based on published research, the following formula and parameters are recommended:

Assuming a sensitivity of 85% for the IFN-γ/IL-2 FluoroSpot to differentiate ATB from LTBI, a specificity of 90%, a type I error of 0.05, and statistical power of 0.90, the minimum sample sizes required are 50 for the ATB group and 35 for the LTBI group . This calculation ensures sufficient statistical power to detect clinically meaningful differences in diagnostic performance.

Researchers should also consider factors such as the prevalence of tuberculosis in the study population, anticipated dropout rates, and the need for subgroup analyses when determining final sample sizes. For validation studies in different geographical regions or populations with varying TB epidemiology, sample sizes may need to be adjusted accordingly.

What experimental controls are essential when working with Rv1733c in immunological studies?

When conducting immunological studies with Rv1733c, several essential controls should be incorporated:

  • Negative controls: Unstimulated PBMCs to establish baseline cytokine production

  • Positive controls: PBMCs stimulated with mitogenic agents (e.g., PHA) to confirm cell viability and functionality

  • Antigen specificity controls: Well-characterized MTB antigens such as ESAT-6 and CFP-10 to benchmark responses against established markers

  • Non-TB mycobacterial antigens: To assess cross-reactivity with environmental mycobacteria

  • Healthy control subjects: To establish normal range of responses in non-infected individuals

  • Technical replicates: To ensure assay reproducibility

In animal studies evaluating Rv1733c SLP as a vaccine candidate, appropriate controls include animals immunized with CpG alone versus those immunized with Rv1733c p57-84/CpG . This allows for proper assessment of antigen-specific responses versus adjuvant effects.

How should researchers interpret conflicting cytokine profiles in response to Rv1733c stimulation?

When encountering conflicting cytokine profiles in response to Rv1733c stimulation, researchers should consider several factors. First, the disease status significantly impacts cytokine production patterns, with LTBI subjects typically showing higher levels of IL-2 production in response to Rv1733c compared to ATB patients . The differential IL-2 response is particularly valuable for distinguishing between these conditions.

The frequency of single IL-2-secreting T cells stimulated by Rv1733c SLP has been shown to have the largest area under the ROC curve (0.766) for differentiating ATB from LTBI . When interpreting results, researchers should focus on this parameter rather than IFN-γ responses alone, which may not show significant differences between groups.

Additionally, researchers should consider technical variables such as antigen concentration, incubation time, and the specific assay format (ELISA, ELISpot, or flow cytometry), which can all influence cytokine detection. Patient-specific factors including age, comorbidities, immunosuppression, and previous BCG vaccination status can also affect immune responses to Rv1733c and should be accounted for during data interpretation.

What experimental design best evaluates the potential of Rv1733c as a vaccine candidate?

The optimal experimental design for evaluating Rv1733c as a vaccine candidate should follow a comprehensive approach:

  • Preclinical Studies:

    • Immunogenicity assessment in animal models (particularly HLA-DR3 transgenic mice to mimic human responses)

    • Comparison of whole Rv1733c protein versus Rv1733c SLP formulations

    • Evaluation of different adjuvant combinations (CpG has shown promise)

    • Challenge studies with virulent MTB strains to assess protection

  • Immune Response Characterization:

    • Analysis of both cellular (CD4+ and CD8+ T cell responses) and humoral immunity

    • Cytokine profiling (IFN-γ, IL-2, TNF-α, IL-17) to assess Th1/Th17 polarization

    • Memory T cell formation and persistence over time

    • Functional assays (e.g., mycobacterial growth inhibition)

  • Dosing and Formulation Studies:

    • Dose-ranging studies to determine optimal antigen concentration

    • Prime-boost strategies (homologous vs. heterologous)

    • Delivery system evaluation (e.g., liposomes, viral vectors, nanoparticles)

The experimental design should include appropriate controls and follow Good Laboratory Practice (GLP) standards to ensure data quality and reproducibility in preparation for potential clinical translation.

How can researchers optimize experimental conditions to detect subtle differences in immune responses to Rv1733c between ATB and LTBI?

To optimize detection of subtle differences in immune responses to Rv1733c between ATB and LTBI, researchers should implement several strategies:

  • Multiparameter Analysis: Simultaneously measure multiple cytokines (not just IFN-γ) with particular focus on IL-2, which has shown significant differences between ATB and LTBI groups . The differential IL-2 secretion between these groups stimulated by Rv1733c SLP is particularly informative for differentiation.

  • Cell Subset Analysis: Beyond bulk PBMC responses, analyze specific T cell subsets (effector, memory, regulatory) using flow cytometry or mass cytometry to identify population-specific differences that might be masked in whole PBMC assays.

  • Kinetic Studies: Measure responses at multiple time points (e.g., 24h, 48h, 72h) to capture differences in the kinetics of cytokine production between ATB and LTBI.

  • Antigen Optimization: Use Rv1733c SLP rather than whole protein, as it has demonstrated stronger immune responses and better discrimination between ATB and LTBI .

  • Combined Antigen Approach: Integrate Rv1733c SLP with established MTB antigens such as ESAT-6 and CFP-10 to enhance diagnostic accuracy. This combination has shown improved sensitivity (84.2%) and specificity (83.3%) compared to using ESAT-6 and CFP-10 alone (sensitivity 82.5%, specificity 66.7%) .

  • Statistical Methods: Employ ROC curve analysis to determine optimal cutoff values, and use binary logistic regression models for combining multiple parameters to improve discrimination.

What are the most promising research avenues for enhancing Rv1733c-based diagnostic accuracy?

Several promising research avenues could enhance Rv1733c-based diagnostic accuracy:

  • Epitope Mapping and Optimization: Further refinement of Rv1733c SLP design by identifying and optimizing immunodominant epitopes could enhance specificity and sensitivity of diagnostic tests.

  • Multiplexed Antigen Panels: Development of comprehensive panels that combine Rv1733c SLP with other latency antigens and virulence factors. Current research shows that combining Rv1733c SLP with ESAT-6 and CFP-10 increases the positive predictive value from 79.7% to 88.9% , suggesting that further antigen combinations could yield even better results.

  • Advanced Detection Technologies: Integration of Rv1733c-based detection with microfluidic or nanotechnology platforms for point-of-care applications with increased sensitivity.

  • Machine Learning Algorithms: Development of algorithms that analyze complex patterns of cytokine responses to multiple antigens, potentially identifying signature profiles with higher diagnostic accuracy than single cutoff values.

  • Host Biomarker Integration: Combining Rv1733c-specific immune responses with host-derived biomarkers (e.g., inflammatory markers, transcriptomic signatures) to improve diagnostic algorithms.

  • Longitudinal Studies: Evaluation of Rv1733c-specific responses over time in individuals with LTBI to identify immunological markers that predict progression to active disease.

These approaches could address current limitations in TB diagnostics, particularly the challenge of accurately distinguishing between ATB and LTBI in high-burden settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.