Recombinant Probable menaquinol-cytochrome c reductase cytochrome c subunit (qcrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
qcrC; DIP1626; Cytochrome bc1 complex cytochrome c subunit; Cytochrome bc1 reductase complex subunit Qcrc; Menaquinol--cytochrome c reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Target Names
qcrC
Target Protein Sequence
MTNAKKVRARRKIRRTAAGAMALAVGLTGAGILVNAVTPDAQVATAQQDEQALIQEGKDL YDVACITCHGANLQGVKDRGPSLIGVGSGATYFQVHSGRMPMLRNEAQAKRKTPRYSEAQ TLAIAAYVEANGGGPSIVYNKDGSVAMESLRGANYKDGIDPADVARGSDLFRLNCASCHN FTGRGGALSSGKYAPVLDPANEQEIYQAMLTGPQNMPKFSDRQLSADEKKDIIAYIKSAK ETPSQGGWNLGGLGPVTEGMMMWLVGIVVLVAAAMWIGSRS
Uniprot No.

Target Background

Function

Cytochrome c1 is a subunit of the cytochrome bc1 complex, a crucial component of the respiratory electron transport chain essential for ATP synthesis. This complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c within the respiratory chain, operating via a Q-cycle mechanism. This mechanism couples electron transfer to the generation of a proton gradient, driving ATP synthesis.

Database Links

KEGG: cdi:DIP1626

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is QcrC and what is its function in bacterial metabolism?

QcrC is a cytochrome c subunit of the menaquinol-cytochrome c reductase complex (QcrABC) that functions primarily in oxygen-linked respiration in bacteria, particularly in Campylobacter jejuni. The QcrABC complex serves as a proton-translocating, quinol-cytochrome c reductase that plays a major role in the respiratory chain of phylogenetically diverse prokaryotes . In C. jejuni specifically, QcrC is involved in energy metabolism processes that are essential for bacterial growth and pathogenicity . The protein is membrane-anchored and faces the extracytoplasmic side of the cytoplasmic membrane, functioning as part of an electron transport system that contributes to the generation of proton-motive force .

How conserved is QcrC across Campylobacter species?

QcrC appears to be highly conserved across multiple C. jejuni strains, including several clinical isolates from patients with acute enteritis. Interestingly, research has shown that QcrC exhibits strain specificity within the Campylobacter genus. It is present and functionally important in C. jejuni but is not expressed by closely related species such as C. coli and C. fetus . This conservation pattern makes QcrC a valuable target for C. jejuni-specific interventions, as antibodies developed against this protein have demonstrated specific reactivity to multiple C. jejuni strains without cross-reactivity to other Campylobacter species .

What is the relationship between QcrC expression and bacterial pathogenicity?

Research has established a significant correlation between QcrC expression levels and C. jejuni pathogenicity. Studies indicate that different culture conditions produce varying expression levels of QcrC in C. jejuni, and these levels are closely related not only to the energy metabolism of the bacterium but also to its virulence potential . Higher expression of QcrC appears to be associated with increased pathogenicity, suggesting that QcrC contributes to the bacterium's ability to establish infection and cause disease. This relationship makes QcrC both a marker for pathogenicity and a potential therapeutic target .

What approaches can be used to produce recombinant QcrC for research purposes?

For effective production of recombinant QcrC, researchers typically employ the following methodology:

  • Gene Cloning: The QcrC gene should be amplified from C. jejuni genomic DNA using PCR with specific primers designed based on reference genome sequences. The amplified gene can then be cloned into an expression vector (such as pET series vectors) containing a suitable tag (e.g., His-tag) for purification purposes .

  • Expression System Selection: E. coli BL21(DE3) is commonly used as an expression host due to its high efficiency in producing recombinant proteins. Alternative expression systems may include insect cells or yeast if proper protein folding or post-translational modifications are concerns .

  • Optimization of Expression Conditions: Parameters requiring optimization include:

    • IPTG concentration (typically 0.1-1.0 mM)

    • Induction temperature (16-37°C, with lower temperatures often preferred for membrane proteins)

    • Induction time (4-24 hours)

    • Media composition (e.g., inclusion of specific cofactors or supplements)

  • Protein Extraction and Purification: As a membrane-associated protein, detergent-based extraction methods are recommended. Purification typically involves affinity chromatography (e.g., Ni-NTA for His-tagged proteins) followed by size exclusion chromatography to obtain highly pure protein preparations .

  • Validation of Recombinant Protein: The purified protein should be validated through Western blotting with anti-QcrC antibodies, mass spectrometry, and functional assays to ensure that the recombinant protein retains its native structure and activity .

How can researchers design experiments to study QcrC's role in oxygen-limited growth?

To effectively study QcrC's role in oxygen-limited growth conditions, researchers should consider the following experimental design approaches:

  • Generation of qcrABC Deletion Mutants: Create gene deletion mutants using allelic exchange methods or CRISPR-Cas9 targeting the qcrABC genes individually and as a complex. Complementation strains should also be developed to confirm phenotype restoration .

  • Growth Curve Analysis Under Controlled Oxygen Conditions:

    • Use anaerobic chambers or microaerobic incubators with precise control of oxygen levels

    • Compare growth patterns of wild-type, qcrABC mutant, and complemented strains under various oxygen tensions (e.g., aerobic, microaerobic, anaerobic conditions)

    • Monitor growth using OD600 measurements at regular intervals for 24-72 hours

  • Alternative Electron Acceptor Utilization Assays:

    • Test growth and substrate utilization with different electron acceptors (oxygen, nitrate, TMAO, fumarate)

    • Measure reduction rates of these alternative electron acceptors using colorimetric assays

    • Quantify end products to determine metabolic flux

  • Enzyme Activity Measurements: Develop assays to measure the specific activity of the QcrABC complex in membrane fractions under different growth conditions, using menaquinol analogues as substrates and appropriate electron acceptors .

  • Membrane Potential and Proton Gradient Analysis: Employ fluorescent probes (such as DiSC3(5) or BCECF) to assess the effect of QcrC deletion on proton-motive force generation under oxygen-limited conditions .

What methodologies are recommended for evaluating QcrC as a vaccine candidate?

Based on recent research, the following methodological framework is recommended for evaluating QcrC as a vaccine candidate:

  • Immunogenicity Assessment:

    • Recombinant QcrC protein should be formulated with appropriate adjuvants (e.g., aluminum hydroxide, CpG)

    • Immunize mice using prime-boost strategies with different dosages (typically 10-50 μg protein per dose)

    • Collect serum samples at regular intervals to analyze antibody titers using ELISA

    • Characterize antibody responses (IgG subclasses, IgA) and assess cellular immune responses (T-cell proliferation, cytokine profiles)

  • Challenge Studies:

    • After immunization, challenge mice with clinically relevant C. jejuni strains

    • Monitor bacterial colonization levels in fecal samples and intestinal tissues

    • Assess clinical signs (weight loss, diarrhea) and tissue pathology

    • Compare protection levels between immunized and control groups

  • Cross-Protection Analysis:

    • Evaluate protection against multiple C. jejuni strains to determine the breadth of vaccine efficacy

    • Test protection against strains with slight variations in QcrC structure

  • Antibody Mechanistic Studies:

    • Isolate anti-QcrC antibodies from immunized animals

    • Perform in vitro growth inhibition assays to determine if antibodies directly inhibit bacterial growth

    • Conduct energy metabolism assays to confirm target engagement and functional inhibition

    • Assess antibody-dependent immune effector functions (complement activation, phagocytosis)

  • Safety Evaluation:

    • Monitor for adverse reactions following immunization

    • Evaluate for autoimmune reactions through testing antibody cross-reactivity with host proteins

    • Perform histopathological analysis of tissues to assess for inflammation or tissue damage

How does QcrC contribute to respiratory flexibility in C. jejuni under oxygen limitation?

C. jejuni demonstrates remarkable respiratory flexibility, which contributes to its survival in diverse environments. QcrC plays a central role in this adaptability, particularly under oxygen-limited conditions. Research has revealed that, contrary to previous assumptions, the periplasmic reduction of alternative electron acceptors like nitrate and trimethylamine-N-oxide (TMAO) in C. jejuni is not independent of the QcrABC complex .

A qcrABC deletion mutant shows complete deficiency in oxygen-limited growth on both nitrate and TMAO and is unable to reduce these oxidants with physiological electron donors. This finding indicates that the periplasmic Nap and Tor reductases receive their electrons via the QcrABC complex in C. jejuni . This explains the general absence of NapC and TorC quinol dehydrogenases in Epsilonproteobacteria, which are typically responsible for these functions in other bacteria.

The specific use of menaquinol (Em -75 mV) coupled with the Qcr complex to drive reduction of nitrate (Em +420 mV) or TMAO (Em +130 mV) against the proton-motive force allows the process to be electrogenic with a H+/2e− ratio of 2 . This mechanism represents an efficient energy conservation strategy under oxygen-limited conditions and demonstrates QcrC's vital role in respiratory adaptation.

What approaches can resolve contradictory data regarding QcrC function across different experimental conditions?

When faced with contradictory data regarding QcrC function across different experimental conditions, researchers should employ a structured contradiction analysis approach. This approach can be formalized using the notation proposed for contradiction patterns in biomedical research, considering three parameters: α (number of interdependent items), β (number of contradictory dependencies), and θ (minimal number of required Boolean rules) .

For QcrC research specifically, the following framework is recommended:

How can high-throughput screening methods be optimized to identify QcrC inhibitors?

To optimize high-throughput screening methods for QcrC inhibitors, researchers should implement the following comprehensive approaches:

  • Assay Development and Validation:

    • Establish a purified recombinant QcrC-based enzymatic assay measuring electron transfer rates using colorimetric or fluorometric readouts

    • Develop whole-cell assays that specifically report on QcrC activity using reporter systems

    • Validate assays using known modulators of cytochrome c function and respiratory chain inhibitors

    • Determine assay quality parameters (Z', signal-to-background ratio, coefficient of variation) to ensure robustness

  • Library Design and Screening Strategy:

    • Employ rational library design focusing on compounds likely to interact with heme-containing proteins

    • Include diversity-oriented libraries to identify novel chemical scaffolds

    • Implement machine learning approaches to predict compounds with higher probability of QcrC interaction

    • Consider both competitive (substrate-binding site) and allosteric inhibitors in the screening strategy

  • Retrospective Designed Sampling for Big Data Analysis:

    • Apply modern decision theoretic optimal experimental design methods

    • Use retrospective designed sampling to maximize information content from screening data

    • Implement active learning approaches to guide compound selection in iterative screening rounds

    • Calculate information determinants to compare efficiency with random selection approaches

  • Confirmation and Validation Cascade:

    • Primary screens at single concentration (typically 10 μM)

    • Dose-response confirmation for initial hits (8-12 concentrations)

    • Orthogonal assays to confirm target engagement (thermal shift assays, surface plasmon resonance)

    • Counter-screens to eliminate compounds acting on unrelated targets

    • Bacterial growth inhibition assays to confirm whole-cell activity

  • Mechanism of Action Studies:

    • Oxygen consumption assays to confirm respiratory chain inhibition

    • Membrane potential measurements to assess effects on proton-motive force

    • Resistance development studies to confirm QcrC as the primary target

    • Crystallography or molecular modeling to determine binding modes

What statistical approaches are recommended for analyzing QcrC immunization data?

For robust analysis of QcrC immunization data, researchers should employ the following statistical approaches:

How should researchers analyze and reconcile inter-strain variability in QcrC expression and function?

When analyzing inter-strain variability in QcrC expression and function, researchers should implement a comprehensive approach:

  • Sequence Analysis Framework:

    • Perform multiple sequence alignment of QcrC genes and proteins from diverse C. jejuni strains

    • Identify conserved domains, variable regions, and potential functional motifs

    • Calculate sequence identity and similarity percentages between strains

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Expression Level Quantification:

    • Use RT-qPCR to quantify transcript levels across strains under standardized conditions

    • Employ Western blot with densitometry for protein level quantification

    • Implement proteomics approaches (LC-MS/MS) for absolute quantification

    • Standardize data using appropriate housekeeping genes/proteins

  • Functional Correlation Analysis:

    • Assess metabolic activity (oxygen consumption, ATP production) in relation to QcrC expression levels

    • Measure growth rates under varying oxygen conditions for multiple strains

    • Determine minimal inhibitory concentrations of QcrC-targeting antibodies across strains

    • Correlate pathogenicity in animal models with QcrC expression/function

  • Statistical Approaches for Strain Comparison:

    • Use one-way ANOVA with post-hoc tests for comparing multiple strains

    • Apply hierarchical clustering to group strains based on QcrC characteristics

    • Implement principal component analysis to identify key variables explaining inter-strain differences

    • Develop regression models relating sequence variations to functional differences

What bioinformatic tools are most effective for analyzing QcrC structure-function relationships?

For comprehensive analysis of QcrC structure-function relationships, the following bioinformatic tools and approaches are recommended:

  • Structural Prediction and Analysis:

    • AlphaFold2 or RoseTTAFold for accurate protein structure prediction

    • SWISS-MODEL for homology modeling based on related cytochrome c structures

    • PyMOL or UCSF Chimera for structural visualization and analysis

    • CASTp or POCASA for pocket and cavity detection to identify potential binding sites

    • HADDOCK or AutoDock for molecular docking simulations with potential inhibitors

  • Sequence-Based Functional Analysis:

    • Pfam, PROSITE, and InterPro for domain and motif identification

    • ConSurf for evolutionary conservation analysis to identify functionally important residues

    • SignalP and TMHMM for signal peptide and transmembrane domain prediction

    • PROVEAN or SIFT for predicting the functional impact of amino acid substitutions

    • Clustal Omega or MUSCLE for multiple sequence alignment of QcrC across species

  • Network and Systems Biology Approaches:

    • STRING for protein-protein interaction network analysis

    • Cytoscape for visualizing and analyzing molecular interaction networks

    • KEGG or BioCyc for metabolic pathway mapping and analysis

    • Flux balance analysis (FBA) for modeling the metabolic impact of QcrC alterations

    • EcoCyc or BioCyc for comparative analysis with other bacterial respiratory systems

  • Evolutionary Analysis Tools:

    • MEGA for phylogenetic tree construction and molecular evolutionary analyses

    • PAML for detection of sites under positive selection

    • FunDi or GroupSim for detection of functional divergence between clusters of sequences

    • CLANS for analysis of protein families based on all-against-all BLAST comparisons

What factors determine the efficacy of QcrC-based vaccines against C. jejuni?

The efficacy of QcrC-based vaccines against C. jejuni is determined by several critical factors:

  • Antigen Design and Formulation:

    • Use of full-length recombinant QcrC versus selected immunodominant epitopes

    • Protein conformation and preservation of critical epitopes

    • Selection of appropriate adjuvants to enhance immunogenicity

    • Delivery system and route of administration (intramuscular, mucosal)

  • Host Immune Response Factors:

    • Antibody subclass distribution (IgG1, IgG2a/c, IgA)

    • T-cell response profile (Th1, Th2, Th17)

    • Duration of immune memory

    • Mucosal immunity development in the intestinal tract

    • Pre-existing immunity to related antigens

  • Bacterial Factors:

    • Conservation of QcrC across relevant C. jejuni strains

    • Level of QcrC expression during infection

    • Accessibility of QcrC to antibodies in vivo

    • Potential for immune escape through antigenic variation

    • Bacterial fitness cost of evolving resistance

  • Vaccination Protocol Variables:

    • Dose and dosing schedule (prime-boost intervals)

    • Age at vaccination

    • Host genetic factors affecting response to vaccination

    • Nutritional status and concurrent infections

Recent studies have demonstrated that immunization of mice with recombinant QcrC induced protective immunity against C. jejuni infection, with significant reduction in bacterial colonization following challenge . The antibody response specifically targeted QcrC and was found to inhibit the energy metabolism and growth of C. jejuni, highlighting the potential of this approach for vaccine development.

How can QcrC antibodies be optimized for therapeutic applications?

To optimize QcrC antibodies for therapeutic applications, researchers should consider the following approaches:

  • Antibody Engineering Strategies:

    • Humanization of murine antibodies to reduce immunogenicity

    • Affinity maturation to enhance binding to QcrC

    • Fc engineering to optimize effector functions (complement activation, ADCC)

    • Format selection (IgG, Fab, scFv) based on desired tissue penetration and half-life

    • Development of bispecific antibodies targeting QcrC and another bacterial factor

  • Production and Formulation Optimization:

    • Selection of expression systems for high-yield production (CHO cells, HEK293)

    • Purification strategies to maintain functional activity

    • Stability enhancement through formulation optimization

    • Development of long-acting formulations for extended protection

  • Mechanism of Action Enhancement:

    • Target epitope selection to maximize functional inhibition of QcrC

    • Combination with antibiotics to achieve synergistic effects

    • Engineering for enhanced mucosal delivery and retention

    • Development of antibody-antibiotic conjugates for targeted delivery

  • Preclinical Evaluation Framework:

    • In vitro assessment of functional inhibition across diverse C. jejuni strains

    • Evaluation of resistance development potential

    • PK/PD studies to determine optimal dosing regimens

    • Efficacy studies in relevant animal models (colonization prevention, treatment)

  • Delivery System Considerations:

    • Oral delivery systems for intestinal targeting

    • Local versus systemic administration

    • Use of microencapsulation for controlled release

    • Development of engineered probiotics expressing anti-QcrC antibody fragments

What is the impact of bacterial metabolism on QcrC-targeted therapeutic approaches?

Understanding the impact of bacterial metabolism on QcrC-targeted therapeutic approaches is critical for developing effective interventions:

  • Metabolic State-Dependent Expression:

    • QcrC expression levels vary significantly based on culture conditions and metabolic state

    • Different expression levels are closely related to both energy metabolism and pathogenicity

    • Oxygen availability is a key determinant of QcrC function and expression

  • Respiratory Flexibility Considerations:

    • C. jejuni can utilize multiple electron acceptors (oxygen, nitrate, TMAO, fumarate)

    • QcrC is essential for oxygen-limited growth on nitrate and TMAO, but not on fumarate

    • Therapeutic strategies must account for this respiratory flexibility

  • Metabolic Adaptation Mechanisms:

    • Bacteria may adapt to QcrC inhibition by upregulating alternative respiratory pathways

    • Growth rate and metabolic demand affect the vulnerability to QcrC targeting

    • Nutrient availability in different host niches influences the critical nature of QcrC function

  • Combination Strategy Rationale:

    • Targeting QcrC alongside other metabolic pathways may prevent adaptation

    • Combining QcrC inhibitors with conventional antibiotics may exploit metabolic vulnerability

    • Simultaneous targeting of aerobic and anaerobic respiration components may enhance efficacy

  • Host Environment Influences:

    • Intestinal oxygen gradient affects the importance of QcrC in different regions

    • Inflammation alters the gut environment, potentially affecting QcrC expression

    • Diet and microbiome composition influence metabolic dependencies of C. jejuni

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.