Recombinant Probable menaquinol-cytochrome c reductase iron-sulfur subunit (qcrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type in your order for preferential development.
Synonyms
qcrA; DIP1625; Cytochrome bc1 complex Rieske iron-sulfur subunit; Cytochrome bc1 reductase complex subunit QcrA; Menaquinol--cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Target Names
qcrA
Target Protein Sequence
MSNNPEMNYTSKELDAMSNEELARLGTELDGVTVAYRKERFPVEGDPASKRASRTVGIWF GIGIVSALAFLAVYLFMPWEYKGLGEDGLWIYTFYTPLLGLTSGLAILSLGIGVIFYIKK IIPSEISVQRRHDGPSEEIDRRTITALLNDSWETSTLGRRKVLKSMLGIGGVLAGLTIIA PLGGMVKNPWKKGELGIQGDGTLWTSGWTLHEKGVKLYLGRDTGVTAEKHETSVGTHYST QGVSRLIRMRPEDLAAAAMETVFPLPAEFVNDGDKYDASADVYEEQMHSIHGPRNAVMLI RLRNSDANKVIEREGQEDFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQSQFDAL HYGKPVFGPAARALPQLPITVDEEGYLVAAGNFIEPVGPAFWERRS
Uniprot No.

Target Background

Function
The iron-sulfur subunit of the cytochrome bc1 complex is a crucial component of the respiratory electron transport chain, essential for ATP synthesis. This complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c, functioning via a Q-cycle mechanism that couples electron transfer to proton gradient generation, which drives ATP synthesis.
Database Links

KEGG: cdi:DIP1625

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is QcrA and what is its role in bacterial respiration?

QcrA is the Rieske iron-sulfur protein subunit of the menaquinol:cytochrome c reductase complex (also known as the bc complex) in bacteria such as Bacillus subtilis. The QcrA protein is a component of the respiratory electron transport chain that catalyzes electron transfer from menaquinol to c-type cytochromes .

The bc complex in B. subtilis represents a distinct class of bc-type complexes that differs from the more commonly studied bc₁ and b₆f complexes. QcrA contains a high-potential [2Fe-2S] Rieske-type cluster that functions as an electron carrier in this respiratory pathway . As part of the three-subunit menaquinol:cytochrome c reductase (QcrABC complex), it plays a critical role in energy generation through the proton-motive force across the cytoplasmic membrane .

How is the QcrA protein structurally organized?

QcrA in B. subtilis is a 167-amino acid protein containing a characteristic Rieske-type [2Fe-2S] cluster . The protein has a domain organization that includes:

  • A membrane-anchoring domain that secures it to the cytoplasmic membrane

  • A soluble domain containing the iron-sulfur cluster that extends into the periplasmic space

  • Conserved cysteine and histidine residues that coordinate the [2Fe-2S] cluster

The iron-sulfur cluster in QcrA is coordinated by two cysteine and two histidine residues in a highly conserved arrangement typical of Rieske proteins. This coordination scheme contributes to the relatively high redox potential of the [2Fe-2S] cluster compared to other iron-sulfur proteins .

What experimental approaches are used to study QcrA function in bacterial systems?

Multiple experimental approaches have been employed to characterize QcrA function:

Experimental ApproachApplicationKey Technical Considerations
Genetic manipulationCreation of qcrA deletion mutants to assess respiratory phenotypesRequires complementation studies to confirm specificity of effects
Spectroscopic analysisCharacterization of iron-sulfur cluster propertiesUV/Visible spectroscopy for cluster integrity; EPR for redox state analysis
Protein localizationDetermination of membrane association and complex formationSubcellular fractionation; immunodetection with specific antibodies
Respiratory measurementsAssessment of electron transport activityOxygen consumption assays; artificial electron acceptor/donor studies
Stress response analysisEvaluation of QcrA's role in stress conditionsGrowth under various oxidative stress conditions; ROS detection methods

These methodologies have established that QcrA is essential for proper respiratory function, particularly under oxygen-limited conditions, and that its absence affects growth on nitrate and TMAO but not on fumarate .

What are the optimal conditions for recombinant expression of QcrA protein?

The expression of recombinant QcrA presents challenges due to the requirement for proper iron-sulfur cluster insertion. Based on available research, the following methodological approach is recommended:

  • Expression system selection: While E. coli is commonly used for recombinant protein expression, mammalian cell lines like Chinese hamster ovary (CHO) cells can be advantageous for proper folding and post-translational modifications of complex proteins like QcrA .

  • Vector optimization: The addition of regulatory elements such as Kozak sequences and leader peptides upstream of the target gene significantly enhances expression levels of recombinant proteins . For QcrA specifically:

    • Include the native Tat signal peptide if membrane insertion is desired

    • Consider fusion tags that do not interfere with iron-sulfur cluster formation

  • Culture conditions: Supplement growth media with iron sources (ferric ammonium citrate) and induction at lower temperatures (16-18°C) to promote proper folding and cluster assembly .

  • Co-expression strategies: Co-express iron-sulfur cluster assembly proteins (e.g., ISC or SUF system components) to enhance cluster incorporation when expressing QcrA in heterologous systems .

The implementation of this methodological framework has been shown to improve both transient and stable expression of complex iron-sulfur proteins, with yields sufficient for biochemical and structural characterization .

How can iron-sulfur cluster integrity be maintained during QcrA purification?

Maintaining the integrity of the [2Fe-2S] cluster in QcrA during purification is critical for functional studies. The following protocol has been validated for preserving cluster integrity:

  • Anaerobic conditions: Perform all purification steps under strict anaerobic conditions (e.g., in an anaerobic chamber with 2-5% H₂ atmosphere) to prevent oxidative damage to the iron-sulfur cluster .

  • Buffer composition:

    • Include reducing agents such as DTT (1-5 mM) or β-mercaptoethanol

    • Maintain pH between 7.5-8.0

    • Include glycerol (10-15%) to stabilize the protein structure

    • Consider adding small amounts of detergent (0.01-0.05% dodecyl maltoside) if purifying the membrane-bound form

  • Cluster reconstitution: If cluster loss occurs during purification, reconstitution can be performed using established protocols:

    • Treat apo-protein with DTT (5 mM) in anaerobic conditions

    • Add ferric ammonium citrate at 4:1 stoichiometry (iron to protein)

    • Add Li₂S slowly at equimolar ratio to iron

    • Remove unbound iron and sulfide by size exclusion chromatography

  • Assessment of cluster integrity: Monitor the characteristic absorption spectrum between 350-450 nm, which is indicative of [4Fe-4S] or [2Fe-2S] clusters .

Attention to these methodological details has been shown to preserve up to 85-90% of iron-sulfur cluster integrity during purification, enabling meaningful functional and structural analyses .

What factors affect iron-sulfur cluster stability in QcrA?

Research has identified several critical factors that influence the stability of the [2Fe-2S] cluster in QcrA:

  • Metal ion interactions: Copper ions, particularly Cu(I), have been shown to destabilize iron-sulfur clusters in proteins like QcrA. Even submicromolar concentrations of Cu(I) can significantly affect cluster stability, while Cu(II) has less impact . This sensitivity to copper is relevant for:

    • Understanding how metal stress affects respiratory function

    • Designing purification protocols that avoid copper contamination

    • Interpreting results from experiments conducted in metal-containing buffers

  • Oxidative conditions: The iron-sulfur cluster in QcrA is sensitive to oxidative damage. Exposure to:

    • Superoxide radicals

    • Hydrogen peroxide

    • Oxygen under certain conditions
      can lead to cluster degradation and loss of function .

  • Disulfide bond formation: The integrity of disulfide bonds in the Rieske domain of QcrA is critical for proper folding and stability of the iron-sulfur cluster. Mutations that prevent disulfide bond formation lead to rapid degradation of the protein .

Understanding these factors is essential when designing experiments to study QcrA function and for interpreting results in the context of cellular stress responses.

How does the coordination environment affect the redox properties of the QcrA iron-sulfur cluster?

The unique coordination environment of the [2Fe-2S] cluster in QcrA has substantial effects on its redox properties:

  • Coordination chemistry: Unlike typical ferredoxin-type [2Fe-2S] clusters that are coordinated by four cysteines, the Rieske-type cluster in QcrA features coordination by two cysteines and two histidines. This coordination scheme results in:

    • Higher reduction potential (approximately +150 to +300 mV vs. standard hydrogen electrode)

    • Altered pH dependence of the redox potential due to the protonatable histidine ligands

    • Different spectroscopic signatures in EPR and UV-visible spectroscopy

  • Structure-function correlations: The redox properties of the QcrA iron-sulfur cluster are directly related to its function in the respiratory chain:

  • Fe-S covalency effects: High-energy resolution fluorescence detected X-ray absorption spectroscopy (HERFD-XAS) studies of iron-sulfur clusters similar to those in QcrA reveal that Fe-S bond covalency evolves with the oxidation state, impacting reactivity. The all-ferric state shows distinctive discontinuity in covalency patterns compared to mixed-valence states .

How does QcrA contribute to electrogenic respiration in bacteria?

QcrA plays a crucial role in electrogenic respiration through its participation in the QcrABC complex. Research has revealed the following mechanisms:

  • Proton-motive electron transfer: The QcrABC complex (containing QcrA) functions as a proton-motive menaquinol-cytochrome c reductase that couples electron transfer to proton translocation across the cytoplasmic membrane. This process:

    • Oxidizes menaquinol (E°'≈ -75 mV)

    • Transfers electrons through the iron-sulfur cluster in QcrA to cytochrome c

    • Contributes to the proton-motive force with a H⁺/2e⁻ ratio of 2

  • Role in alternative respiratory pathways: Contrary to previous assumptions, studies in C. jejuni have demonstrated that QcrABC is essential for electron transport to periplasmic Nap and Tor reductases, which mediate nitrate and TMAO respiration:

    • A qcrABC deletion mutant was completely deficient in oxygen-limited growth on both nitrate and TMAO

    • The mutant was unable to reduce these oxidants with physiological electron donors

    • Growth on fumarate remained normal under oxygen-limited conditions

This finding is significant because it demonstrates that periplasmic Nap and Tor reductases receive electrons via QcrABC rather than through direct quinol dehydrogenases, explaining the general absence of NapC and TorC quinol dehydrogenases in Epsilonproteobacteria .

What role does QcrA play in bacterial stress responses and antimicrobial resistance?

Recent research has identified several critical roles for QcrA in bacterial stress responses:

  • Reactive oxygen species (ROS) generation: Under conditions of membrane depolarization, QcrA has been implicated as a source of lethal levels of superoxide radicals:

    • Evidence suggests that QcrA delocalizes after membrane depolarization

    • Detachment of QcrA from complex III potentially leads to superoxide radical formation

    • This mechanism may explain why membrane-targeting compounds are successful in eradicating antibiotic-tolerant persister cells

  • Metal stress responses: QcrA and its iron-sulfur cluster are key targets of copper toxicity:

    • Copper ions, particularly Cu(I), destabilize the iron-sulfur cluster

    • This destabilization leads to a cascade of events affecting iron homeostasis

    • The resulting deregulation affects multiple pathways associated with iron and sulfur homeostasis

  • Regulatory network: A proposed model of interdependent copper, iron, and sulfur homeostasis suggests that:

    • Cluster-destabilized scaffold proteins like QcrA enhance intracellular sequestration of iron and sulfide pools during copper stress

    • This results in increased ratios of apo-Fur repressor, releasing expression of iron acquisition genes

    • There is also upregulation of sulfur assimilation and cysteine biosynthesis pathways

These findings provide insight into the complex interplay between metal homeostasis, respiratory function, and antimicrobial resistance mechanisms in bacteria.

What mechanisms govern QcrA translocation across the bacterial membrane?

QcrA translocation across the bacterial cytoplasmic membrane involves the twin-arginine translocation (Tat) pathway, which has stringent requirements for cargo protein folding and cofactor insertion:

  • Tat pathway specificity: Unlike the Sec pathway, which transports unfolded proteins, the Tat pathway specifically transports folded and cofactor-containing proteins like QcrA:

    • The pathway is named for the conserved twin-arginine motif in the signal peptide of its cargo proteins

    • It forms a channel large enough to accommodate folded proteins

    • In B. subtilis, TatAy components are particularly important for QcrA translocation

  • Proofreading hierarchy: Research has uncovered a hierarchical quality control system for QcrA translocation:

    • QcrA mutants defective in disulfide bonding are quickly degraded

    • Mutants defective in cofactor binding accumulate in the cytoplasm and membrane

    • This indicates that proper oxidative folding is verified before cofactor attachment is assessed

This proofreading hierarchy ensures that only properly folded and functional QcrA proteins with intact iron-sulfur clusters are translocated to their final destination in the membrane.

What methodologies can detect QcrA misassembly in bacterial mutants?

Several methodological approaches can be employed to detect and characterize QcrA misassembly in bacterial mutants:

  • Subcellular fractionation: Differential centrifugation coupled with western blotting can determine the localization of QcrA in different cellular compartments:

    • Properly assembled QcrA is predominantly in the membrane fraction

    • Misassembled protein may accumulate in the cytoplasmic fraction

    • Quantitative analysis of these fractions provides insight into assembly efficiency

  • Spectroscopic analysis: UV-visible and EPR spectroscopy can assess iron-sulfur cluster incorporation:

    • Properly assembled QcrA shows characteristic absorption between 350-450 nm

    • Misassembled protein lacks these spectral features

    • Time-course analysis can track cluster degradation kinetics

  • Protease sensitivity assays: Differential protease sensitivity can distinguish between properly folded and misfolded QcrA:

    • Properly folded protein shows specific protease-resistant fragments

    • Misfolded protein typically exhibits increased protease sensitivity

    • This approach can be combined with mass spectrometry for detailed structural information

  • Respiratory activity measurements: Functional assays measuring electron transfer rates can detect subtle defects in QcrA assembly:

    • Membrane preparations are assessed for menaquinol:cytochrome c reductase activity

    • Activity correlations with protein levels can identify partially active complexes

    • Temperature-dependent activity profiles can reveal thermolability associated with misassembly

These complementary approaches provide a comprehensive assessment of QcrA assembly status and can identify specific defects in the assembly pathway.

How can Quantitative Chemical Risk Assessment (QCRA) methodologies be applied to research involving QcrA?

Quantitative Chemical Risk Assessment (QCRA) methodologies can be adapted to assess risks in research involving QcrA and similar proteins:

  • Probabilistic approach: QCRA offers a probabilistic procedure that accounts for uncertainties in both exposure and hazard assessments :

    • This approach quantifies risks in terms of probability distributions rather than deterministic values

    • For QcrA research, this could address uncertainties in protein stability, reactivity, and potential toxicity

    • QCRA has proven more effective than deterministic approaches in supporting intervention prioritization

  • Application to QcrA research:

QCRA ComponentApplication to QcrA ResearchMethodological Approach
Uncertainty analysisAssessment of variability in iron-sulfur cluster stabilitySensitivity analysis of experimental conditions
Risk characterizationEvaluation of potential ROS generation in different systemsProbabilistic modeling of electron leakage scenarios
Intervention prioritizationIdentification of critical control points in experimental protocolsCost-benefit analysis of different stabilization strategies
  • Implementation framework: A QCRA approach for QcrA research would involve:

    • Identifying key variables affecting experimental outcomes (e.g., oxygen exposure, metal contamination)

    • Developing probabilistic distributions for these variables

    • Simulating outcomes under different experimental conditions

    • Quantifying uncertainties in the results to inform experimental design

This approach could help researchers optimize experimental conditions and interpret results within a more robust statistical framework.

What emerging techniques will advance our understanding of QcrA function in the next decade?

Several emerging technologies and methodologies are positioned to significantly advance our understanding of QcrA function:

  • High-resolution cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM resolution will allow:

    • Determination of the complete structure of the QcrABC complex

    • Visualization of conformational changes during electron transfer

    • Mapping of interaction interfaces with other respiratory components

  • Advanced spectroscopic methods: Cutting-edge spectroscopic techniques provide new insights into iron-sulfur cluster properties:

    • High energy resolution fluorescence detected X-ray absorption spectroscopy (HERFD-XAS) at the S K-edge can measure Fe-S bond covalencies and their variation with iron oxidation state

    • This reveals how covalency changes affect the reactivity of iron-sulfur clusters

    • Time-resolved spectroscopy can capture intermediate states during electron transfer

  • Systems biology approaches: Integration of QcrA function into broader cellular contexts:

    • Protein interaction network mapping using proximity labeling techniques

    • Metabolic flux analysis to quantify the contribution of QcrA to cellular energetics

    • Computational modeling of electron transport chains incorporating QcrA dynamics

  • Synthetic biology applications: Engineering QcrA for novel functions:

    • Design of QcrA variants with altered redox properties for biotechnological applications

    • Creation of minimal respiratory chains incorporating engineered QcrA for bioenergy applications

    • Development of QcrA-based biosensors for metal ions and redox state

These emerging approaches will provide a more comprehensive understanding of QcrA's role in bacterial physiology and potentially open new avenues for biotechnological applications and antimicrobial development.

What standardized protocols should be followed when comparing QcrA function across different bacterial species?

To ensure meaningful cross-species comparisons of QcrA function, researchers should adhere to the following standardized protocols:

  • Sequence and structural analysis:

    • Perform comprehensive phylogenetic analysis of QcrA homologs

    • Map conserved and variable regions to functional domains

    • Model species-specific structural differences using homology modeling approaches

  • Expression and purification standardization:

    • Use consistent expression systems across species comparisons

    • Standardize buffer compositions and anaerobic handling procedures

    • Quantify iron-sulfur cluster content using consistent methodologies

  • Functional characterization:

    • Measure electron transfer rates under identical conditions

    • Standardize electron donor and acceptor concentrations

    • Control for membrane composition effects through reconstitution experiments

  • Data reporting standards:

    • Include detailed methodological descriptions to ensure reproducibility

    • Report key parameters such as redox potentials, kinetic constants, and spectroscopic features

    • Provide raw data in standardized formats to facilitate meta-analyses

Adherence to these standardized protocols will enhance the comparability of results across different studies and bacterial species, advancing our collective understanding of QcrA function in diverse bacterial systems.

How can contradictory research findings about QcrA function be reconciled?

Reconciling contradictory findings about QcrA function requires a systematic approach:

  • Methodological differences assessment:

    • Compare experimental conditions (aerobic vs. anaerobic, buffer compositions, etc.)

    • Evaluate protein preparation methods (membrane-bound vs. solubilized)

    • Consider genetic background differences in the bacterial strains used

  • Species-specific variations:

    • Acknowledge that QcrA function may vary between bacterial species

    • Consider evolutionary adaptations to different ecological niches

    • Evaluate the composition of the complete respiratory chain in each species

  • Integrative analysis framework:

    • Develop computational models that can incorporate seemingly contradictory data

    • Use Bayesian approaches to weight evidence based on methodological robustness

    • Consider context-dependent regulation that may explain divergent results

  • Collaborative verification studies:

    • Design multi-laboratory studies with standardized protocols

    • Implement blinded analyses to reduce confirmation bias

    • Share reagents and bacterial strains to eliminate material variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.