Recombinant Probable mitochondrial import inner membrane translocase subunit Tim17 (tim-17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
timm-17B.1; tim-17; timm-17; E04A4.5; Probable mitochondrial import inner membrane translocase subunit tim-17B.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
tim-17
Target Protein Sequence
MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAKGKKLVGMMREVRMRSTLT GVQFAAWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVI LAMIEGVGLVTTRWMGAMMDPTQPPPEALDDPRSLGQKSQAEPGLDQTRPFGIPTGLPNL S
Uniprot No.

Target Background

Function
Essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: cel:CELE_E04A4.5

STRING: 6239.E04A4.5.2

UniGene: Cel.6756

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Tim17 and what is its primary function in mitochondria?

Tim17 is an essential subunit of the presequence translocase of the mitochondrial inner membrane (TIM23 complex), which represents the major route for importing nuclear-encoded proteins into mitochondria. Approximately 60% of more than 1,000 different mitochondrial proteins are synthesized with amino-terminal targeting signals called presequences, which form positively charged amphiphilic α-helices. Tim17's primary function is to facilitate the translocation of these presequence-containing proteins across or into the inner mitochondrial membrane .

Research methodologically approaches this by using isolated mitochondria and recombinant proteins to study translocation processes. Techniques such as site-directed mutagenesis of Tim17 followed by functional assays reveal that Tim17 contains conserved negative charges near the intermembrane space side of the bilayer that are essential for initiating presequence protein translocation .

How does Tim17 differ structurally and functionally from other components of the TIM23 complex?

Tim17 belongs to the Tim17 protein family, which also includes Tim23 and Tim22. While previously Tim23 was thought to be the channel-forming component of the TIM23 complex, recent evidence shows that Tim17 is actually the major subunit directly involved in translocation of presequence proteins across the inner membrane .

Structurally, Tim17 contains four transmembrane domains that form a curved surface, with a lateral cavity opening to the lipid bilayer similar to Tim22. Unlike traditional channel proteins, Tim17 facilitates protein translocation at the bilayer interface. Methodologically, researchers can distinguish the functions of these proteins through:

  • Crosslinking experiments with matrix-targeted and inner membrane-sorted preproteins

  • Site-specific mutations followed by functional assays

  • Structural modeling using cryo-EM structures of related proteins as templates

What experimental systems are most commonly used to study Tim17 function?

Experimental SystemApplicationAdvantagesLimitations
Yeast (S. cerevisiae)Genetic manipulation and functional studiesWell-established genetic tools, viable temperature-sensitive mutantsLess direct relevance to human systems
Isolated mitochondriaIn organello import assaysNative membrane environment, assessment of membrane potential dependenceComplex preparation, limited time window for experiments
Recombinant protein systemsStructural studies, interaction analysesPure protein samples, controlled conditionsMay not reflect in vivo complexity
Cysteine-specific crosslinkingMapping protein-protein interactionsHigh spatial resolution of interactionsRequires strategic cysteine placement

Methodologically, researchers often combine these systems to study Tim17. For example, temperature-sensitive tim17 mutants are used to correlate crosslinking efficiency with Tim17 activity, demonstrating that precursor protein-Tim17 crosslinking directly correlates with Tim17 function .

How does the lateral cavity of Tim17 contribute to protein translocation?

The lateral cavity of Tim17 plays a central role in protein translocation across the inner mitochondrial membrane. Research has revealed that Tim17 does not form a traditional channel but rather facilitates translocation at the Tim17 bilayer interface .

Methodologically, this was demonstrated through:

  • Modeling Tim17 transmembrane structure using cryo-EM structures of Tim22 from yeast and human as templates

  • Creating point mutations of hydrophilic residues within the lateral cavity (such as Tim17 N64L and Tim17 S114L)

  • Testing the impact of these mutations on protein import into isolated mitochondria

The hydrophilic residues within the lateral cavity, particularly on the matrix side, are crucial for matrix protein translocation. When these residues are mutated to hydrophobic leucine, matrix protein import is specifically impaired while inner membrane protein sorting remains largely unaffected .

What is the Tim17 translocation initiation site (TIS) and how was it identified?

The Tim17 translocation initiation site (TIS) is an acidic patch within the lateral transmembrane cavity of Tim17, located close to the intermembrane space side. This site attracts the positive charge of the N-terminus of incoming precursor proteins, initiating the translocation process .

The TIS was identified through a series of methodological approaches:

  • Sequence conservation analysis identifying conserved negatively charged residues (D17 and D76) in Tim17

  • Site-directed mutagenesis of these residues to alanine

  • Functional import assays showing that mutation of these negatively charged residues impairs import of both matrix-targeted and inner membrane-sorted precursor proteins

  • Position-specific crosslinking demonstrating that presequences interact with these regions during translocation

The double mutant Tim17 D17A_D76A showed pronounced defects in presequence protein import while maintaining normal levels of Tim17, other TIM23 subunits, and membrane potential, confirming the specific role of these negative charges in protein translocation .

How do researchers map the interaction pathway of presequence proteins with Tim17?

Mapping the interaction pathway between presequence proteins and Tim17 involves sophisticated methodological approaches:

  • Site-specific crosslinking:

    • Introducing single cysteine residues at specific positions along the lateral cavity of Tim17

    • Arresting presequence-containing precursor proteins during import

    • Performing cysteine-specific crosslinking to identify interaction sites

    • Analyzing crosslink patterns to determine the translocation pathway

  • Membrane potential-dependent crosslinking:

    • Comparing crosslinking efficiency in the presence and absence of membrane potential

    • Demonstrating that precursor proteins cross the inner membrane in a membrane potential-dependent manner at the lateral cavity of Tim17

  • Cysteine-bispecific crosslinking:

    • Using precursor proteins with single-cysteine residues in the sorting signal

    • Introducing single cysteines along the lateral cavities of Tim17

    • Observing gradual changes in site-specific crosslinking efficiencies

These approaches revealed that arrested precursor proteins associate with the lateral cavity of Tim17 from D76 (on the intermembrane space side) over N64 (in the middle of Tim17-TM2) to K36 (at the matrix side), mapping the entire translocation pathway .

What is the role of membrane potential (Δψ) in Tim17-mediated protein translocation?

The mitochondrial membrane potential (Δψ) is essential for presequence protein translocation across the inner membrane. Based on research findings, it plays multiple critical roles in Tim17-mediated import :

  • Initial extraction support: Membrane potential is crucial for the initial extraction of mitochondrial presequences from the inner membrane

  • Electrophoretic effect: The positive charges of presequences are attracted toward the negative matrix side of the membrane potential

  • PAM motor engagement: Δψ facilitates the emergence of the presequence into the matrix where the essential presequence translocase-associated import motor (PAM) subunit mtHsp70 can bind to the first hydrophobic part of the presequence

Methodologically, researchers demonstrate this dependency through:

  • Import experiments in the presence/absence of membrane potential uncouplers

  • Membrane potential-dependent crosslinking showing that precursor proteins only interact with Tim17's lateral cavity when the potential is present

  • Comparison of matrix versus inner membrane targeting in the context of reduced membrane potential

This understanding helps explain why even partial dissipation of the membrane potential can severely affect protein import into mitochondria .

How do researchers distinguish between the roles of Tim17 and Tim23 in presequence protein import?

Distinguishing between the roles of Tim17 and Tim23 requires sophisticated experimental approaches that specifically target each protein:

ApproachMethodologyKey Findings
Crosslinking analysisSite-specific chemical crosslinking with presequence proteinsPrecursor proteins specifically crosslink with Tim17 but not with comparable positions in Tim23
Point mutationsIntroduction of mutations in conserved residues of both proteinsTim17 mutations in lateral cavity residues specifically impair matrix protein import
Structural modelingComputational modeling based on cryo-EM structuresTim17 and Tim23 form a back-to-back conformation as a functional unit for precursor translocation
Functional complementationTesting which protein can rescue import defectsTim17 (not Tim23) is the major subunit directly involved in translocation

Research shows that contrary to previous assumptions, Tim17 (not Tim23) is the major subunit of the presequence translocase directly involved in translocation of presequence proteins across the inner membrane. Tim23 may play a supportive or regulatory role, but the direct translocation pathway involves the Tim17 lateral cavity .

What are the three major cases of how precursor proteins are translocated after presequence recognition?

Based on the research findings, three major scenarios govern how the mature part of precursor proteins is translocated after presequence recognition :

  • Presequence-like mature part:

    • When the mature part of the precursor has presequence-like features

    • Translocation proceeds as described for presequences themselves

    • The amphiphilic nature facilitates progression through the Tim17 lateral cavity

  • Mature part with non-conducive chemical characteristics:

    • When the mature part has chemical characteristics not attracted by the Tim17 lateral cavity

    • If in α-helical conformation, the import motor driving force causes unfolding on the intermembrane space side

    • The extended chain translocates along the narrow lateral cavity of Tim17, aided by hydrophilic residues

    • Mgr2 association may reduce contact with the lipid bilayer

  • Inner membrane-sorted proteins with transmembrane domains:

    • Translocation at the Tim17 bilayer interface enables lateral release of subsequent transmembrane domains/stop-transfer signals

    • Likely involves dissociation of Mgr2, which modulates the threshold hydrophobicity for membrane insertion

    • Hydrophobic segments can exit laterally into the lipid bilayer

This model explains how a single translocase can handle the diverse range of mitochondrial presequence-containing proteins with different final destinations .

How can researchers effectively study Tim17 mutations and their impact on protein import?

Effective study of Tim17 mutations requires a systematic experimental approach:

  • Strategic mutation design:

    • Target conserved residues identified through sequence alignment across species

    • Focus on charged residues (like D17, D76) or hydrophilic residues (N64, S114) within the lateral cavity

    • Create mutations that alter chemical properties (e.g., charge neutralization, hydrophilic to hydrophobic)

  • Viability assessment:

    • Test growth of yeast strains expressing mutant Tim17 at different temperatures

    • Determine if mutations create temperature-sensitive phenotypes

    • Compare growth rates with wild-type under various stress conditions

  • Biochemical characterization:

    • Confirm proper expression levels of mutant proteins

    • Verify assembly into TIM23 complexes using blue native electrophoresis

    • Assess membrane potential maintenance in isolated mitochondria

  • Functional import assays:

    • Use radiolabeled presequence proteins with different destinations (matrix or inner membrane)

    • Measure import kinetics in isolated mitochondria containing Tim17 mutations

    • Assess processing by mitochondrial processing peptidase (MPP) to determine import efficiency

    • Compare effects on different types of precursors to identify specificity

These approaches have successfully demonstrated that Tim17's negative charges and hydrophilic cavity residues are essential for proper protein import function .

What are the most effective approaches for mapping protein translocation pathways through Tim17?

Mapping protein translocation pathways through Tim17 requires specialized techniques:

  • Chemical crosslinking in organello:

    • Arrest precursor proteins during import using folded domains (like DHFR with methotrexate)

    • Apply chemical crosslinkers to identify proximal proteins

    • Analyze crosslinking products by immunoprecipitation and Western blotting

    • Limitation: Cannot precisely map positions within Tim17

  • Site-specific cysteine crosslinking:

    • Create Tim17 variants with single cysteines at specific positions

    • Generate presequence precursors with strategically placed cysteines

    • Use cysteine-specific crosslinkers to identify precise interaction points

    • Advantage: Provides spatial resolution within the protein

  • Bispecific crosslinking approach:

    • Combine single-cysteine Tim17 variants with single-cysteine precursor proteins

    • Analyze spatial relationships by crosslinking efficiency patterns

    • Map the entire translocation pathway from intermembrane space to matrix side

  • Membrane potential-dependent crosslinking:

    • Perform crosslinking in the presence/absence of membrane potential

    • Determine which interactions depend on energized mitochondria

    • Provide insights into the energetic requirements of different translocation steps

Using these approaches, researchers have mapped the translocation pathway from the intermembrane space side (D76) through the middle of the cavity (N64) to the matrix side (K36) of Tim17 .

How can the latest structural modeling techniques be applied to study Tim17 function?

Modern structural modeling techniques provide valuable insights into Tim17 function:

  • Template-based modeling:

    • Use cryo-EM structures of related proteins (e.g., Tim22) as templates

    • Build homology models of Tim17 transmembrane structure

    • Compare with AlphaFold predictions for validation

    • Advantage: Provides structural framework when direct structural data is unavailable

  • Machine learning approaches:

    • Apply tools like AlphaFold to predict Tim17 structure

    • Validate predictions through experimental data (crosslinking, mutagenesis)

    • Limitation: May not capture dynamic aspects of the protein

  • Protein-peptide docking:

    • Model interaction between Tim17 and presequence peptides

    • Use ColabFold to model Tim17-Tim23-Mgr2 heterotrimer with presequence

    • Predict specific interaction sites for experimental validation

    • Results show presequence specifically associates with Tim17 lateral cavity

  • Molecular dynamics simulations:

    • Model dynamic behavior of Tim17 in a lipid bilayer

    • Simulate presequence interaction with the lateral cavity

    • Predict conformational changes during translocation

    • Provide testable hypotheses for experimental validation

These computational approaches complement experimental data and have helped reshape understanding of mitochondrial protein import, showing that translocation occurs at the Tim17 bilayer interface rather than through a traditional protein channel .

How does dysfunction of Tim17 contribute to mitochondrial diseases?

While the search results don't directly address Tim17's role in disease, the protein's essential function in mitochondrial protein import suggests several potential disease mechanisms:

  • Impaired protein import efficiency:

    • Mutations affecting Tim17's negative charges or hydrophilic cavity residues would reduce import of matrix proteins

    • This could lead to mitochondrial protein imbalance and dysfunction

    • Progressive cellular energy deficits would particularly affect high-energy tissues (brain, muscle, heart)

  • Differential effects on protein classes:

    • Some Tim17 mutations specifically affect matrix protein import while preserving inner membrane protein sorting

    • This could create unique mitochondrial proteome imbalances

    • Different mutations might present with tissue-specific manifestations

  • Membrane potential dysregulation:

    • Tim17's role in maintaining the inner membrane permeability barrier

    • Dysfunction could lead to membrane potential dissipation

    • Secondary effects on ATP production and mitochondrial quality control

Research methodology for investigating Tim17 in disease contexts would involve:

  • Identification of Tim17 variants in patients with mitochondrial disorders

  • Functional characterization using the experimental approaches described earlier

  • Development of cell and animal models expressing disease-associated Tim17 variants

What therapeutic approaches might target Tim17 function in disease states?

Based on our understanding of Tim17 function, several therapeutic strategies could be envisioned:

  • Small molecule modulators:

    • Compounds that enhance interaction between presequences and the Tim17 translocation initiation site

    • Molecules that stabilize the Tim17-Tim23 interaction in disease-associated unstable variants

    • Screening methodology would involve assessing protein import efficiency in isolated mitochondria

  • Gene therapy approaches:

    • Delivery of wild-type Tim17 to complement defective variants

    • CRISPR-based correction of Tim17 mutations

    • Challenges include mitochondrial-targeted delivery systems

  • Mitochondrial biogenesis promotion:

    • Indirect enhancement of Tim17 function through upregulation of mitochondrial biogenesis

    • Activation of PGC-1α and related transcription factors

    • May compensate for partial Tim17 dysfunction

  • Membrane potential stabilization:

    • Compounds that preserve mitochondrial membrane potential

    • Could enhance protein import efficiency in the context of Tim17 dysfunction

    • Would address a critical requirement for Tim17-mediated translocation

Methodologically, these approaches would be evaluated in cellular and animal models before clinical translation, with protein import efficiency, mitochondrial function, and disease-relevant phenotypes as key outcome measures.

How can Tim17 research inform our understanding of mitochondrial evolution?

The fundamental role of Tim17 in protein import offers insights into mitochondrial evolution:

  • Conservation across species:

    • The Tim17 protein family is highly conserved from yeast to humans

    • Conserved negative charges and hydrophilic cavity residues suggest evolutionary pressure to maintain the translocation mechanism

    • Indicates the fundamental nature of this protein import pathway in eukaryotic life

  • Evolutionary origin of protein import systems:

    • Understanding Tim17's mechanism provides clues about how mitochondria evolved from bacterial endosymbionts

    • The translocation at lipid bilayer interfaces may represent an ancient mechanism that predates dedicated protein channels

    • Comparison with bacterial protein secretion systems could reveal evolutionary relationships

  • Co-evolution with presequences:

    • The match between the amphiphilic nature of presequences and Tim17's translocation mechanism suggests co-evolution

    • The presequence design (positive charges approximately every 3-4 positions) appears optimized for Tim17-mediated import

    • This relationship likely shaped the evolution of mitochondrial targeting signals

Research methodology in this area would involve:

  • Comparative genomics across diverse eukaryotic lineages

  • Functional complementation studies with Tim17 homologs from different species

  • Structural comparison with bacterial protein translocation systems

What are the current technical limitations in Tim17 research, and how might they be overcome?

Current Tim17 research faces several technical challenges:

LimitationDescriptionPotential Solutions
Structural determinationDifficulty obtaining high-resolution structures of membrane protein complexes like TIM23Advanced cryo-EM techniques, nanodiscs for membrane protein stabilization
Dynamic analysesCurrent methods capture static snapshots rather than the dynamic process of translocationSingle-molecule techniques, time-resolved crosslinking approaches
In vivo relevanceMost studies performed in isolated mitochondria or yeast modelsDevelopment of mammalian cell models, tissue-specific analyses
Complete translocation pathwayCrosslinking identifies contact points but not the complete molecular mechanismIntegrative structural biology combining multiple experimental approaches with computational modeling

Methodologically, overcoming these limitations requires development of new techniques and integration of multiple approaches to build a comprehensive understanding of Tim17 function in its native context .

How might the understanding of Tim17's translocation mechanism inform the design of novel protein delivery systems?

The unique mechanism of Tim17-mediated protein translocation offers inspiration for biotechnological applications:

  • Biomimetic delivery systems:

    • Design of synthetic translocation systems based on Tim17's lateral cavity mechanism

    • Creation of amphipathic peptides that mimic presequences for membrane penetration

    • Development of membrane-interface translocation systems for therapeutic protein delivery

  • Engineered mitochondrial targeting:

    • Design of optimized presequences based on understanding of Tim17 interaction requirements

    • Creation of chimeric targeting signals for efficient delivery of therapeutic proteins to mitochondria

    • Methodological approach: systematic variation of presequence properties followed by import efficiency assessment

  • Synthetic biology applications:

    • Engineering of minimal protein translocation systems based on Tim17 principles

    • Creation of artificial organelles with controlled protein import properties

    • Application in synthetic cell development and biocontainment strategies

The insights from Tim17 research suggest that protein translocation can occur efficiently at lipid bilayer interfaces rather than requiring dedicated protein channels, which represents a paradigm shift that could inspire novel approaches to membrane protein delivery .

What are the most promising directions for investigating the coordinated function of the entire TIM23 complex?

Future research on the coordinated function of the TIM23 complex should focus on:

  • Structural characterization of the complete TIM23 complex:

    • Cryo-EM analysis of the intact complex with stalled preproteins

    • Determination of the spatial arrangement of all subunits during different stages of translocation

    • Methodological challenges include stabilizing the complex and capturing different functional states

  • Dynamics of complex assembly and disassembly:

    • Investigation of how TIM23 complex composition changes during protein import

    • Analysis of the role of Mgr2 in complex dynamics and lateral release of membrane proteins

    • Approaches might include live-cell imaging of fluorescently tagged components and single-molecule tracking

  • Integration with the presequence translocase-associated motor (PAM):

    • Elucidation of how the Tim17-mediated translocation coordinates with PAM activity

    • Analysis of the energy transduction between membrane potential driving force and ATP-dependent motor function

    • Reconstitution of coupled TIM23-PAM function in defined systems

  • Tissue and condition-specific regulation:

    • Investigation of how TIM23 complex function is regulated in different tissues and under stress conditions

    • Analysis of post-translational modifications of Tim17 and other complex components

    • Development of methods to study protein import in intact tissues and organisms

These research directions would build upon the fundamental insight that Tim17 is the major translocating component of the TIM23 complex and would lead to a comprehensive understanding of this essential cellular machinery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.