Recombinant Probable muscarinic acetylcholine receptor gar-2 (gar-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Probable Muscarinic Acetylcholine Receptor gar-2 (gar-2)

Recombinant Probable Muscarinic Acetylcholine Receptor gar-2 (gar-2) is a Caenorhabditis elegans-derived G protein-coupled receptor (GPCR) that mediates inhibitory signaling in cholinergic motor neurons. It belongs to the muscarinic acetylcholine receptor (mAChR) family, which regulates diverse physiological processes, including neuromuscular contraction, sensory neuron activity, and pharyngeal function. The recombinant form of gar-2 is engineered for research purposes, typically expressed in heterologous systems like E. coli and purified to high homogeneity (>90%) for functional and structural studies .

Biochemical Characterization

The recombinant gar-2 protein is a full-length construct (1–627 amino acids) fused with an N-terminal His-tag for affinity purification. Key biochemical features include:

ParameterSpecification
Source OrganismCaenorhabditis elegans (nematode model organism)
Expression HostE. coli
Protein LengthFull-length (627 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) recommended for stability

This recombinant protein is lyophilized and stored at -20°C/-80°C to preserve activity .

Functional Roles in C. elegans

gar-2 functions as a metabotropic receptor that inhibits cholinergic motor neurons, modulating locomotion and neuromuscular signaling. Key findings include:

  • Inhibitory Feedback Regulation: gar-2 activation reduces acetylcholine (ACh) release from motor neurons, dampening excitatory signals .

  • Tissue-Specific Expression:

    • Body Wall Muscle: Regulates muscle contraction and relaxation.

    • Sensory Neurons: Modulates sensory input processing.

    • Pharynx: Controls feeding behavior .

  • Ligand Responsiveness: Unlike mammalian mAChRs, gar-2 shows limited affinity for classical muscarinic agonists (e.g., oxotremorine, arecoline) and antagonists (e.g., atropine, scopolamine) .

Pharmacological Profiling

gar-2 exhibits a distinct pharmacological profile compared to other muscarinic receptors:

Ligandgar-2 ResponseGAR-3 Response (Contrast)
Acetylcholine (ACh)Inhibits motor neurons via GPCR signaling Activates G-protein pathways
Oxotremorine (OXO)Minimal/no effect Potent agonist (EC₅₀ ~138.8 nM)
AtropineNo inhibition Blocks GAR-3 activity (IC₅₀ ~27.3 nM)
ScopolamineNo inhibition Effective antagonist

These data suggest gar-2 operates via non-canonical signaling pathways or requires unique ligand interactions distinct from GAR-3 or mammalian mAChRs .

Research Applications

The recombinant gar-2 protein enables advanced studies in GPCR biology and parasitology:

  1. GPCR Drug Discovery:

    • Screens for anthelmintic compounds targeting nematode GARs in Brugia malayi and Trichinella spiralis .

    • Functional assays to identify subtype-selective ligands .

  2. Neuromodulation Studies:

    • Analysis of inhibitory feedback mechanisms in cholinergic circuits .

    • Role in locomotion defects when gar-2 is knocked out or overexpressed .

  3. High-Throughput Assays:

    • Image-based feeding assays to monitor pharyngeal activity in C. elegans .

    • Multivariate phenotyping of microfilariae motility and morphology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
gar-2; F47D12.1; Muscarinic acetylcholine receptor gar-2; G-protein-linked acetylcholine receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-627
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
gar-2
Target Protein Sequence
MAVASVLLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLIGLEGIP VYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTP GRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMTNPYLNMGMYISYYW TTLFVMLYLYWGIYRAAKKLALKSDQKTKRLALLTEMRRPEVSVRTSDAGNSSSDSPNDT SNSSKCFRTAPPTTTVQTTQTNVGTPPPVFRNHMTLHNNNMDFTKDNEIVRPPTPPDDNT YSNPNFSMISEQLTNGFSRQEPSSVIERESTAPCVSPEPSHASLENEFNENHHAHFKPEL SLPFIDADSVSSMVGHDDLRRAMSIRISRSVSMQGTARATPVIEIVENLEEALKICENLE ELREDENKNEEEKQKNGLENGGMNHVIIANDEQQPSTSKESEQKEEMTPENHDPNEVKVP LIAVSRVESVKSTAGGKVRRLITQMRSHSIRSKRKANKNKSVLSALNFFQRKKEYKSRSE NRARKALRTITFILGSFIILWTPFYVLATIYGFCETCKASPSFNTLYTISYYLCYMNSPL NPFCYAMANQQFKKTLTRIFKGDFRRV
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover. This receptor regulates the activity of ventral cord motor neurons. It couples to the G(o) alpha G-protein subunit goa-1 to negatively regulate cholinergic receptor activity in the presence of high levels of the neurotransmitter acetylcholine in ventral cord motor neurons. As acetylcholine depolarizes body wall muscles, modulation of acetylcholine levels likely results in the control of locomotory behavior and egg-laying.
Gene References Into Functions
  1. This study identifies a muscarinic receptor (GAR-2) and the GABA(B) receptor dimer (GBB-1/2) that detect synaptically released ACh and GABA and regulate locomotion. PMID: 18614679
Database Links

UniGene: Cel.8076

Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon.
Tissue Specificity
Expressed in putative sensory neurons, many cells of the ventral cord and in the HSN motor neurons. Expressed in some cholinergic motor neurons and GABAergic motor neurons, which are the two major types of ventral cord motor neurons.

Q&A

What is the probable muscarinic acetylcholine receptor GAR-2 and how does it relate to other muscarinic receptors?

The probable muscarinic acetylcholine receptor GAR-2 belongs to the larger family of muscarinic acetylcholine receptors (mAChRs), which are G protein-coupled receptors (GPCRs) in the α-branch of class A GPCRs. Like other muscarinic receptors, GAR-2 likely functions in regulating various physiological processes through acetylcholine signaling. Muscarinic receptors typically comprise a family of five related subtypes that regulate numerous fundamental functions of both central and peripheral nervous systems .

Research methodological approach: When studying GAR-2 in relation to other muscarinic receptors, researchers should consider sequence homology analysis, phylogenetic tree construction, and comparative binding studies with known muscarinic ligands to establish its classification within the mAChR family.

What experimental models are most appropriate for studying GAR-2 function?

The most effective experimental models for studying GAR-2 function include:

Experimental ModelAdvantagesLimitations
Gene knockout modelsAllows assessment of physiological rolesMay have compensatory mechanisms
Conditional knockout miceTissue/cell-type specific deletionRequires crossing with Cre-expressing lines
Recombinant cell linesControlled expression systemMay lack physiological context
Native tissue preparationsPhysiologically relevantComplex signaling environment

Methodology: For initial characterization, researchers should establish recombinant expression systems using standard cell lines (HEK293, CHO) for pharmacological profiling. Subsequently, genetic knockout models can be developed using CRISPR-Cas9 technology to evaluate physiological roles in vivo. Recent studies with novel mAChR mouse models have provided valuable insights into the physiological roles of different mAChR subtypes .

How can I verify successful recombinant expression of GAR-2?

To verify successful recombinant expression of GAR-2:

  • Western blot analysis using GAR-2-specific antibodies or epitope tags

  • Quantitative PCR to measure mRNA expression levels

  • Radioligand binding assays using muscarinic receptor ligands

  • Functional assays measuring downstream signaling (cAMP production, calcium mobilization)

  • Immunofluorescence microscopy for subcellular localization

Methodological approach: Combine at least two orthogonal techniques to verify expression. For example, western blot confirmation followed by functional characterization using a cAMP accumulation assay if GAR-2 couples to Gαs proteins, similar to how researchers study related GPCRs .

What strategies can be employed to develop subtype-selective ligands for GAR-2?

Developing subtype-selective ligands for GAR-2 requires multiple strategic approaches:

  • Allosteric modulation: Target distinct allosteric sites rather than the orthosteric binding site. This approach has been successful for other muscarinic receptors where most new ligands with high selectivity bind to distinct allosteric sites .

  • Bitopic ligand design: Develop bitopic molecules that simultaneously interact with both allosteric and orthosteric receptor sites. Such agents offer new opportunities to target specific mAChR subtypes for therapeutic purposes .

  • Structure-guided design: Utilize structural information from related muscarinic receptors. Recent determination of mAChR structures (M2 and M3 subtypes) represents a milestone that has provided molecular views of these receptors in both inactive and active conformations .

Methodological approach: Begin with computational modeling based on related muscarinic receptor structures, followed by medicinal chemistry optimization and high-throughput screening using recombinant GAR-2 expression systems.

How do I design a proper two-group experiment to establish cause-effect relationships in GAR-2 signaling?

To design a robust two-group experiment for establishing cause-effect relationships in GAR-2 signaling:

  • Formulate a clear hypothesis: Create a testable hypothesis based on predicted GAR-2 functions (e.g., "GAR-2 activation increases neuronal excitability through cAMP signaling").

  • Identify variables:

    • Independent variable: GAR-2 activation (treatment with selective agonist)

    • Dependent variable: Measured outcome (e.g., cAMP levels, calcium flux, downstream gene expression)

    • Control variables: All other experimental conditions

  • Establish experimental and control groups:

    • Experimental group: Cells/tissues receiving GAR-2 selective agonist

    • Control group: Identical cells/tissues receiving vehicle only

  • Randomization and blinding: Implement randomization in sample selection and blind the experimenter to treatment conditions when possible .

  • Statistical considerations: Determine appropriate sample size through power analysis to ensure statistical validity of results .

Methodological approach: In executing the experiment, maintain identical conditions between experimental and control groups except for the key treatment variable. For example, when testing a GAR-2 agonist's effect on cell signaling, ensure both groups receive the same media, incubation time, and measurement protocols, differing only in the presence/absence of the agonist .

How can genomic approaches be used to study GAR-2 expression and regulatory mechanisms?

Genomic approaches for studying GAR-2 expression and regulation include:

  • Recombinant population genome construction (RPGC): This approach can accelerate the transformation of non-model species into genome-enabled systems by simultaneously producing a de novo genome assembly while determining individual genotypes .

  • ChIP-seq analysis: Identify transcription factors and regulatory elements controlling GAR-2 expression.

  • ATAC-seq: Map chromatin accessibility at the GAR-2 locus to identify potential regulatory regions.

  • RNA-seq: Quantify GAR-2 expression across different tissues or under various conditions.

  • Single-cell transcriptomics: Characterize cell-type specific expression patterns of GAR-2.

Methodological approach: For comprehensive characterization, combine RNA-seq data with ChIP-seq analysis of epigenetic marks associated with active enhancers (H3K27ac) and promoters (H3K4me3) to identify regulatory elements. The deep sequencing coverage obtained from recombinant population approaches can be particularly valuable for identifying allelic variants and regulatory elements .

What are the best practices for distinguishing between GAR-2 paralogues and allelic variants?

Distinguishing between GAR-2 paralogues and allelic variants requires a systematic approach:

  • Sequence comparison: Conduct thorough sequence alignment to identify conserved domains versus variable regions. Paralogues typically show differences in functional domains, while allelic variants often differ at specific nucleotide positions.

  • Frequency analysis: In recombinant populations derived from inbred parents, informative variable sites for alleles should appear at approximately 50% frequency, following Mendelian predictions .

  • Linkage analysis: Map the genomic locations of suspicious sequences. Paralogues will map to different chromosomal regions, while alleles map to the same locus.

  • Functional characterization: Test the pharmacological profiles of expressed proteins. Paralogues often exhibit distinct functional properties.

  • Evolutionary analysis: Construct phylogenetic trees to determine whether sequences diverged before or after speciation events.

Methodological approach: Implement a recombinant population genome construction approach where you can use the segregation patterns of variants in F2 populations to distinguish paralogues from alleles. Specifically, identify sites with only two alleles present, with each allele represented by multiple high-quality reads .

How do I optimize recombinant expression systems for structural and functional studies of GAR-2?

Optimizing recombinant expression of GAR-2 for structural and functional studies requires careful consideration of several factors:

Expression SystemBest ForConsiderations
E. coliProtein fragments, purificationOften requires refolding, lacks post-translational modifications
Insect cellsFull-length functional proteinBetter for structural studies, more native-like glycosylation
Mammalian cellsFunctional assays, native-like processingHighest fidelity for signaling studies, lower yield

Methodological approach:

  • Codon optimization: Adjust codon usage to match the expression host for improved translation efficiency.

  • Fusion tags selection:

    • N-terminal tags: FLAG, His6, or T4 lysozyme for structural studies

    • C-terminal tags: GFP for expression monitoring and localization studies

  • Expression vector optimization:

    • Use strong, inducible promoters (CMV for mammalian cells)

    • Include enhanced untranslated regions for improved stability

  • Host cell selection:

    • HEK293T cells for functional studies

    • Sf9/Sf21 insect cells for structural biology applications

  • Culture condition optimization:

    • Temperature modulation (typically 30-32°C) during expression

    • Addition of pharmacological chaperones like antagonists during expression

This approach aligns with strategies used for structural studies of other muscarinic receptors, where the first structural views were obtained using optimized expression systems .

What analytical techniques are most appropriate for characterizing GAR-2 signaling pathways?

For comprehensive characterization of GAR-2 signaling pathways, employ multiple complementary techniques:

  • cAMP accumulation assays: If GAR-2 couples to Gαs proteins, measure cAMP production using ELISA, FRET-based sensors, or radioimmunoassay. This approach is particularly relevant as muscarinic receptors can activate adenylate cyclase resulting in cAMP synthesis .

  • Calcium mobilization assays: Monitor intracellular calcium using fluorescent indicators (Fura-2, Fluo-4) or genetically encoded calcium indicators (GCaMPs).

  • Phosphoprotein analysis:

    • Western blotting for key signaling nodes (ERK, JNK, PKA)

    • Phosphoproteomics for unbiased pathway mapping

  • Receptor trafficking: Monitor internalization and recycling using fluorescently tagged receptors and confocal microscopy.

  • Transcriptional readouts: Measure changes in gene expression using reporter assays or RNA-seq following receptor activation.

  • Protein-protein interactions: Use bioluminescence resonance energy transfer (BRET) or co-immunoprecipitation to identify interacting partners.

Methodological approach: Begin with canonical GPCR signaling assays (G-protein coupling) followed by investigation of non-canonical pathways (β-arrestin recruitment). For muscarinic receptors, it's important to distinguish between G-protein dependent and G-protein independent signaling through β-arrestin via JNK or ERK pathways .

How can I develop selective knockout models to study GAR-2 function in specific tissues?

To develop selective knockout models for studying GAR-2 function in specific tissues:

  • Conditional knockout strategy: Generate mice containing 'floxed' versions of the GAR-2 gene, where critical exons are flanked by loxP sites.

  • Tissue-specific Cre lines: Cross floxed GAR-2 mice with transgenic mice expressing Cre recombinase under tissue-specific promoters.

  • Temporal control: Consider using inducible Cre systems (e.g., tamoxifen-inducible CreERT2) for temporal control of gene deletion.

  • Validation:

    • Genomic PCR to confirm recombination

    • qPCR and western blot to verify reduction in expression

    • Immunohistochemistry to assess tissue-specific deletion

Methodological approach: This conditional knockout approach has been successfully used for studying other muscarinic receptors, where crossing mice containing floxed versions of specific mAChR genes with Cre-expressing mice has enabled analysis of receptor function in specific tissues or cell types .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.