Recombinant Shigella flexneriNitrite transporter NirC (nirC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C. Lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
nirC; SF3386; S4377; Nitrite transporter NirC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Shigella flexneri
Target Names
nirC
Target Protein Sequence
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLVMGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVAMLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKFIAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVFMGLGYWYATPKANRPVADKFNQTETAAG
Uniprot No.

Target Background

Function
Catalyzes nitrite uptake and nitrite export across the cytoplasmic membrane.
Database Links

KEGG: sfx:S4377

Protein Families
FNT transporter (TC 2.A.44) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the key considerations when designing recombinant Shigella flexneri strains for research purposes?

When designing recombinant S. flexneri strains, researchers should consider several critical factors. First, determine whether the gene of interest should be expressed from a plasmid or integrated into the genome. Genomic integration, as demonstrated with the eltb gene for ETEC heat-labile enterotoxin B (LTB), provides enhanced stability and consistent expression compared to plasmid-based systems . Second, consider the promoter selection to ensure appropriate expression levels. Third, verify expression using appropriate assays such as GM1-capture ELISA, which can confirm successful production of recombinant proteins . Finally, conduct proteomic analysis to verify that the recombinant protein doesn't disrupt the expression of essential virulence factors and outer membrane proteins like OmpA, OmpC, IcsA, and SepA .

How do bacterial membrane transporters function, and what methods are available to study them in Shigella?

Bacterial membrane transporters are integral membrane proteins that facilitate the movement of specific substrates across cellular membranes. These transporters can be studied through multiple approaches. Growth analysis under substrate-limited conditions can reveal transporter functionality, as demonstrated with the SitC iron transporter in S. flexneri, where growth curves were compared between wild-type and mutant strains under iron-limited conditions using chelators like DIP . Complementation studies, where the wild-type phenotype is restored by adding the substrate (as shown with Fe²⁺, Fe³⁺, or Mn²⁺ supplementation in SitC studies), can confirm transporter specificity . Additionally, gene expression analysis using microarrays can identify regulatory networks associated with transporter function, revealing how related metabolic pathways respond to substrate limitation .

What are the best methods for confirming successful gene knockout or integration in Shigella flexneri?

Successful gene modification in S. flexneri can be confirmed through multiple complementary approaches. PCR verification using primers that flank the target region can confirm the presence or absence of the gene of interest. Phenotypic assays that test for the function associated with the gene provide functional validation; for example, growth analyses under specific conditions, as demonstrated with SitC mutants under iron limitation . Transcriptomic analysis using microarrays or RNA-seq can verify changes in gene expression patterns, as shown in studies comparing wild-type S. flexneri and SitC mutants . Finally, proteomic analysis can confirm the absence of the protein product and identify any consequential changes in the expression of other proteins that might compensate for the knockout .

How should researchers design experiments to evaluate the immunogenic potential of recombinant Shigella strains?

Experimental design for evaluating immunogenicity of recombinant Shigella strains should follow a structured approach. Begin with in vitro characterization, including verification of antigen expression through techniques like ELISA or Western blotting . For OMV-based vaccines, isolate and characterize vesicles using proteomic analysis to confirm the presence of target antigens and major outer membrane proteins . Progress to animal models to assess immunogenicity, measuring both humoral and cellular immune responses. Consider evaluating protection through challenge studies in appropriate animal models, such as those established for Shigella vaccines . For maximum translational value, design experiments that address cross-protection against multiple serotypes, as demonstrated in VirG vaccine research which showed protection against both S. flexneri 2a and S. sonnei . Finally, include relevant controls, including comparisons to wild-type strains and established vaccine candidates to benchmark immunogenicity.

What approaches can be used to analyze changes in bacterial gene expression in response to transporter mutations?

Analyzing changes in gene expression due to transporter mutations requires comprehensive transcriptomic approaches. Microarray analysis has been successfully applied to compare gene expression profiles between wild-type S. flexneri and transporter mutants like SitC . This approach revealed that transporter mutations affect expression of genes involved in multiple cellular processes, including energy metabolism, membrane transport, carbohydrate metabolism, and amino acid metabolism . When designing such experiments, include appropriate growth conditions that challenge the transporter function, such as substrate-limited media. For nitrite transporters or similar systems, consider analyzing expression under varying nitrite concentrations or anaerobic conditions that might influence transporter activity. Quantitative RT-PCR can validate expression changes for specific genes of interest identified through broader transcriptomic approaches. Additionally, proteomic analysis can complement transcriptomic data by confirming translation of differentially expressed genes into functional proteins .

How can researchers effectively compare the functionality of wild-type versus mutant bacterial transporters?

Comparing wild-type and mutant transporter functionality requires a multi-faceted approach. First, establish growth curve analyses under substrate-limited and substrate-replete conditions, as demonstrated with SitC mutants grown with iron chelator DIP at different concentrations . This reveals growth phenotypes associated with transporter function. Second, conduct substrate uptake assays using radiolabeled or fluorescently labeled substrates to directly measure transport activity. Third, perform complementation studies by supplementing cultures with the transporter substrate or related compounds to determine if normal growth can be restored, as shown with the addition of Fe²⁺, Fe³⁺, or Mn²⁺ to SitC mutants . Fourth, analyze expression of genes regulated by substrate availability to determine downstream effects of transporter mutation. Finally, consider in vivo virulence studies in appropriate infection models to assess the contribution of the transporter to pathogenesis.

How can researchers integrate transporter studies with vaccine development for Shigella?

Integrating transporter studies with vaccine development requires strategic considerations of both bacterial physiology and immunology. Bacterial transporters like iron acquisition systems are often upregulated during infection and may represent potential vaccine targets if surface-exposed . When developing attenuated live vaccines, consider whether transporter mutations might provide appropriate attenuation while maintaining immunogenicity. For example, iron transport mutants might have reduced virulence while still colonizing sufficiently to induce protective immunity. Outer membrane vesicle (OMV) vaccines, like those developed from recombinant S. flexneri expressing LTB, contain various outer membrane proteins, potentially including transporters . When designing such vaccines, conduct proteomic analyses to characterize the full complement of antigens present, identifying any transporters that might contribute to protection. Finally, evaluate whether combining recombinant antigen expression (like LTB) with transporter mutations might enhance vaccine efficacy through multiple mechanisms .

What are the key challenges and strategies when studying cross-serotype protection in Shigella vaccine research?

Studying cross-serotype protection presents several challenges due to Shigella's diverse serotypes. Researchers must address the complexity of developing broad protection against three species: S. sonnei, S. dysenteriae 1, and multiple S. flexneri serotypes . A strategic approach involves identifying conserved antigens that can provide cross-protection. For example, the VirG (IcsA) protein has shown promising results as a broadly protective antigen against multiple Shigella serotypes . When conducting such studies, ensure robust challenge models using different serotypes to validate cross-protection. Consider both parenteral and mucosal immunization routes, as the latter has shown enhanced protection with certain antigens like VirGα administered intranasally with adjuvants . Additionally, analyze immune responses to determine correlates of protection that function across serotypes, distinguishing between serotype-specific responses (typically to O-antigens) and broader protective mechanisms. Finally, consider combination approaches that include both conserved protein antigens and serotype-specific components to achieve comprehensive protection .

How can researchers effectively investigate the role of bacterial transporters in host-pathogen interactions during Shigella infection?

Investigating transporters in host-pathogen interactions requires sophisticated approaches that bridge microbiology, cell biology, and immunology. Develop cell culture infection models using relevant intestinal epithelial cells to study how transporter expression changes during cellular invasion and intracellular replication. Use transcriptomic and proteomic analyses comparing bacteria in culture versus those isolated from infected cells to identify transporters upregulated during infection . Consider generating reporter strains where transporter promoters drive fluorescent protein expression to visualize activation in real-time during infection. For advanced studies, employ tissue-specific models like intestinal organoids that better recapitulate the complexity of the intestinal environment. Analyze how host responses, including nutritional immunity mechanisms that restrict bacterial access to essential nutrients, interact with bacterial transporter systems. Finally, validate findings in appropriate animal models of shigellosis, potentially using transporter mutants to assess their contribution to colonization, dissemination, and pathology .

What are the optimal approaches for purifying and characterizing outer membrane vesicles (OMVs) from recombinant Shigella strains?

Purification and characterization of OMVs from recombinant Shigella require rigorous methodology. Begin with collection of culture supernatants, followed by differential centrifugation and ultrafiltration to remove cells and concentrate vesicles . Further purify OMVs using density gradient ultracentrifugation to separate vesicles from soluble proteins and other contaminants. Characterize vesicle size and morphology using techniques such as dynamic light scattering and electron microscopy. For compositional analysis, perform proteomic characterization using LC-MS/MS to identify the complete protein complement, as demonstrated with recombinant S. flexneri OMVs containing LTB along with native Shigella proteins like OmpA, OmpC, IcsA, SepA, and Ipa proteins . Verify the presence and quantity of recombinant antigens using specific immunoassays such as GM1-capture ELISA for LTB . Additionally, analyze lipid content and endotoxin levels, especially for vaccine applications. Finally, assess stability under various storage conditions to determine optimal preservation methods for maintaining vesicle integrity and antigen immunogenicity.

What techniques provide the most comprehensive analysis of bacterial gene expression changes in response to environmental stimuli?

Comprehensive analysis of bacterial gene expression requires integrating multiple advanced techniques. RNA sequencing (RNA-seq) offers advantages over microarrays by providing single-nucleotide resolution and capturing novel transcripts and small RNAs. When designing RNA-seq experiments, include biological replicates and appropriate controls for growth conditions. Complementary approaches include ribosome profiling to assess translation and ChIP-seq to identify regulatory protein binding sites that control expression responses. Consider time-course experiments to capture the dynamic nature of expression changes following environmental perturbations, as demonstrated in studies examining iron-limited conditions . For specific pathways, reporter constructs fusing promoters of interest to fluorescent proteins can enable real-time monitoring of expression changes. Metabolomic analysis can complement transcriptomic data by revealing changes in metabolite levels that may drive or result from gene expression changes. Finally, integrate datasets using computational approaches to construct comprehensive regulatory networks that explain how bacteria sense and respond to environmental changes, providing a systems-level understanding of transporter regulation and function .

How can researchers effectively combine in vitro and in vivo approaches to study bacterial transporter function in Shigella pathogenesis?

Effectively combining in vitro and in vivo approaches requires careful experimental design and validation at multiple levels. Begin with in vitro characterization of transporter function using growth assays under substrate-limited conditions, as demonstrated with SitC mutants . Progress to cell culture infection models using relevant cell types like intestinal epithelial cells to assess how transporter function affects invasion, replication, and cytotoxicity. For more complex in vitro systems, consider polarized epithelial monolayers or intestinal organoids that better recapitulate the complexity of intestinal tissue. Transition to animal models of shigellosis, comparing wild-type and transporter mutant strains for colonization, dissemination, and disease manifestations. When designing in vivo experiments, consider both acute infection models and those that examine long-term colonization. Use techniques like in vivo expression technology (IVET) or recombination-based in vivo expression technology (RIVET) to identify transporter genes activated specifically during infection. Finally, validate findings through complementation studies where the wild-type transporter is reintroduced to mutant strains to confirm that observed phenotypes result specifically from transporter dysfunction .

How might bacterial transporter research inform novel therapeutic approaches against Shigella?

Bacterial transporter research has significant potential to inform novel therapeutic approaches against Shigella. Transporters essential for pathogen survival or virulence represent attractive drug targets, particularly given rising antibiotic resistance . Structure-based drug design targeting transporters can lead to novel inhibitors that block essential nutrient acquisition. For example, inhibitors of iron-acquisition systems like SitC could potentially attenuate bacterial growth under the iron-limited conditions encountered during infection . Combination approaches targeting multiple transporters simultaneously might reduce the development of resistance. Additionally, transporter research informs vaccine development by identifying surface-exposed transporters as potential antigens or attenuating mutations that could create live-attenuated vaccine strains. Researchers should prioritize transporters unique to pathogens or structurally distinct from human transporters to minimize toxicity concerns. Finally, consider how transporter inhibition might be combined with existing antibiotics to enhance efficacy through synergistic effects that compromise bacterial metabolism while blocking antibiotic efflux.

What are the most promising approaches for developing cross-protective vaccines against multiple Shigella serotypes?

Developing cross-protective Shigella vaccines requires innovative strategies to overcome serotype diversity. Conserved protein antigens represent one of the most promising approaches. The VirG (IcsA) protein has demonstrated significant potential as a broadly protective antigen, with studies showing that the surface-exposed alpha domain (VirGα) provides protection against both S. flexneri 2a and S. sonnei when administered with appropriate adjuvants . This protein-based approach has advantages over serotype-specific strategies, as VirG is highly conserved across Shigella strains. Another promising strategy involves pentavalent vaccine formulations containing S. sonnei, S. dysenteriae 1, and three carefully selected S. flexneri serotypes that collectively express all group-specific antigens . For maximum efficacy, researchers should consider combination approaches that integrate conserved protein antigens with O-antigen components. Additionally, investigate innovative delivery platforms such as OMVs, which naturally contain multiple antigens including outer membrane proteins and lipopolysaccharide, potentially providing broader protection . Finally, consider novel adjuvant formulations and delivery routes, as intranasal administration with mucosal adjuvants like dmLT has shown enhanced protection compared to parenteral immunization for some antigens .

How can systems biology approaches enhance our understanding of bacterial transporter networks and their role in pathogenesis?

Systems biology approaches offer powerful tools for understanding the complex role of bacterial transporters in pathogenesis. Multi-omics integration, combining transcriptomics, proteomics, and metabolomics data, can reveal how transporter mutations ripple through bacterial physiology . Network analysis can identify regulatory hubs that control multiple transporters in response to environmental conditions, providing potential targets for broad-spectrum intervention. Metabolic flux analysis can determine how altered transport affects downstream metabolic pathways, identifying potential metabolic vulnerabilities created by transporter dysfunction. Machine learning approaches analyzing large datasets can identify non-obvious patterns in gene expression and metabolite levels that might reveal novel regulatory mechanisms. Host-pathogen interaction models incorporating both bacterial and host transcriptomics can elucidate how bacterial transporters interact with host nutritional immunity defenses. Additionally, genome-scale metabolic modeling can predict the consequences of transporter inhibition on bacterial growth and virulence. Finally, comparative systems analyses across multiple pathogens can identify conserved and unique aspects of transporter function, potentially revealing broadly applicable therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.