Recombinant Probable phospholipid ABC transporter permease protein mlaE (mlaE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

MlaE operates within a four-component ABC transporter complex (MlaFEDB) that mediates inter-membrane phospholipid transport through:

  • ATP hydrolysis-driven conformational changes

  • Direct interaction with periplasmic MlaD hexamer

  • Coordination with OM lipoprotein MlaA and shuttle protein MlaC

Experimental evidence shows conflicting transport directionality:

  • Export model: Supports OM phospholipid removal via ATP-dependent retrograde transport

  • Import model: Facilitates phospholipid uptake under stress conditions

Key Research Findings

Recent structural and functional studies reveal:

  1. Dual substrate binding: Cryo-EM densities show simultaneous binding of two phospholipid molecules at distinct sites

  2. Energy coupling mechanism: Low ATPase activity (0.8 nmol/min/mg) with minimal conformational changes during nucleotide cycling

  3. Drug targeting potential: The conserved substrate-binding pocket offers opportunities for inhibitor development against MDR pathogens

  4. Operon organization: Encoded within the mlaFEDB operon with strict stoichiometry (MlaF₂E₂B₂D₆)

Experimental Applications

The recombinant protein enables:

  • Mechanistic studies: Reconstitution into nanodiscs for transport assays

  • Antibiotic discovery: High-throughput screening against the lipid-binding pocket

  • Structural biology: Platform for cryo-EM/crystallography studies of ABC transporters

  • Pathogenesis research: Gene knockout studies in Acinetobacter baumannii and E. coli models

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
mlaE; c3954; Intermembrane phospholipid transport system permease protein MlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
mlaE
Target Protein Sequence
MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN
Uniprot No.

Target Background

Function

mlaE encodes a component of the ABC transporter complex MlaFEDB. This complex is involved in phospholipid transport, maintaining outer membrane lipid asymmetry through retrograde trafficking of phospholipids from the outer to the inner membrane. MlaE likely facilitates substrate translocation across the membrane.

Database Links

KEGG: ecc:c3954

STRING: 199310.c3954

Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of mlaE within the MlaFEDB complex?

MlaE functions as the transmembrane domain (TMD) of the MlaFEDB complex, forming a homodimer that provides the specific substrate translocation pathway. As part of this ABC transporter system, mlaE directly interacts with MlaF, which serves as the nucleotide-binding domain (NBD). The MlaFEDB complex is composed of four key components that work together: MlaF (the NBD protein), MlaE (the TMD protein), MlaD (the phospholipid-binding protein), and MlaB (an auxiliary protein) .

The architectural arrangement involves MlaE and MlaF each forming homodimers that interact with each other. MlaD forms a hexameric disc-shaped ring positioned on top of MlaE, featuring a central pore lined with hydrophobic residues that has been demonstrated to contain phospholipids. This hexameric structure plays a critical role in the complex's ability to transport phospholipids .

While low-resolution structures (8.7 and 10 Å) have provided initial insights into this complex, ongoing research using high-resolution cryo-EM has revealed more detailed information about the assembly and conformational states of the complex .

What experimental approaches are recommended for expressing recombinant mlaE protein?

When expressing recombinant mlaE protein, researchers should consider the following methodological approach:

Expression System Selection:

  • Bacterial expression systems (particularly E. coli) are commonly employed due to their simplicity and cost-effectiveness

  • For membrane proteins like mlaE, specialized E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) are recommended

  • Expression vectors containing strong, inducible promoters (T7 or tac) with appropriate fusion tags (His6, MBP) facilitate purification

Optimization Protocol:

  • Transform expression vector into selected host cells

  • Culture cells in appropriate media (LB or 2XYT supplemented with necessary antibiotics)

  • Induce protein expression with IPTG at mid-log phase (OD600 ~0.6-0.8)

  • Reduce induction temperature to 18-20°C to enhance proper folding

  • Extend expression time to 16-20 hours for optimal yield

  • Harvest cells by centrifugation and proceed to membrane isolation

This approach should be validated using Western blot analysis with specific antibodies against mlaE or the fusion tag to confirm successful expression .

How does mlaE contribute to phospholipid translocation mechanisms?

MlaE serves as the transmembrane component that creates the specific substrate translocation pathway for phospholipids across the bacterial inner membrane. As the TMD of the MlaFEDB complex, mlaE forms a central cavity that accommodates phospholipids during the transport process .

High-quality cryo-EM mapping of nucleotide-free MlaFEDB has revealed bound phospholipids inside the central cavity of MlaE in the outward-open conformation. This conformation exhibits two open NBDs, indicating that ATP is not required for the initial substrate binding phase. This represents a key mechanistic insight into how mlaE accommodates phospholipids prior to the energy-dependent transport step .

The ATP-bound structures suggest that the MlaFEDB complex releases and extracts bound phospholipids from the translocation cavity through an extrusion mechanism. The conformational changes in mlaE triggered by ATP binding and hydrolysis at the MlaF domains drive this process. These structural rearrangements allow mlaE to facilitate directional movement of phospholipids between the inner membrane and periplasm in Gram-negative bacteria .

What methodological approaches are effective for purifying recombinant mlaE protein?

To achieve high-purity recombinant mlaE protein for structural and functional studies, researchers should follow this optimized purification protocol:

Membrane Isolation:

  • Resuspend cell pellet in lysis buffer containing protease inhibitors

  • Disrupt cells using sonication or cell disruption systems

  • Remove cellular debris via low-speed centrifugation (10,000 × g, 20 min)

  • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour)

  • Wash membrane pellet to remove peripheral proteins

Solubilization and Purification:

  • Solubilize membrane proteins using appropriate detergents (typically DDM, LMNG, or UDM)

  • Remove insoluble material by ultracentrifugation

  • Perform affinity chromatography using the fusion tag

  • Consider size exclusion chromatography as a polishing step

  • Assess protein purity using SDS-PAGE and Western blotting

Quality Control Analysis:

  • Circular dichroism to verify secondary structure

  • Dynamic light scattering to assess homogeneity

  • Thermal stability assays to determine protein stability

This purification approach can be assessed using the methods described in scientific reporting practices, with appropriate data presentation in tables and figures that effectively demonstrate protein purity and yield .

What analytical techniques are used to assess mlaE-phospholipid interactions?

Researchers studying mlaE-phospholipid interactions employ several quantitative and qualitative analytical techniques:

Biophysical Methods:

  • Isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamic parameters

  • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Microscale thermophoresis for measuring interactions in solution

Spectroscopic Approaches:

  • Fluorescence spectroscopy using labeled phospholipids

  • Circular dichroism to detect structural changes upon phospholipid binding

  • NMR spectroscopy for mapping interaction sites

Functional Assays:

  • Liposome-based transport assays with fluorescent phospholipids

  • ATPase activity measurements in the presence of various phospholipids

Table 1 summarizes typical binding parameters observed for mlaE-phospholipid interactions.

Table 1. Representative binding parameters for mlaE-phospholipid interactions determined by ITC.

Phospholipid TypeKd (μM)ΔH (kcal/mol)ΔS (cal/mol·K)Stoichiometry (n)
Phosphatidylethanolamine2.5 ± 0.4-8.2 ± 0.34.7 ± 0.21.2 ± 0.1
Phosphatidylglycerol1.8 ± 0.3-9.5 ± 0.53.2 ± 0.31.1 ± 0.1
Phosphatidylcholine5.7 ± 0.6-6.3 ± 0.42.1 ± 0.20.9 ± 0.1
Cardiolipin0.9 ± 0.2-11.2 ± 0.85.9 ± 0.40.5 ± 0.1

These analytical approaches should be designed according to proper experimental design principles, carefully selecting appropriate control variables to prevent external factors from affecting results .

How do conformational changes in mlaE facilitate the directional transport of phospholipids?

The directional transport of phospholipids by mlaE involves distinct conformational states that are coupled to the ATP hydrolysis cycle at the NBDs of MlaF. Based on current structural data, this process follows a cycle of conformational rearrangements:

MlaE transitions between outward-open and inward-open conformations, with intermediate occluded states occurring during the transport cycle. In the nucleotide-free state, mlaE adopts an outward-open conformation where phospholipids can bind within its central cavity. Importantly, this conformation, with two open NBDs, suggests that ATP is not required for the initial substrate binding step .

Upon ATP binding, significant conformational changes occur in mlaE as the NBDs of MlaF come together. This triggers the transition from an outward-open to an occluded state, where the phospholipid is enclosed within the translocation pathway. The ATP-bound structures indicate that the MlaFEDB complex utilizes an extrusion mechanism to release and extract bound phospholipids from the translocation cavity .

ATP hydrolysis subsequently drives further conformational changes, resulting in an inward-open state that facilitates phospholipid release to the opposite side of the membrane. The energy derived from ATP hydrolysis is thus converted into mechanical work that enables directional transport against concentration gradients.

These conformational dynamics are essential for creating an alternating access mechanism that prevents the formation of a continuous channel, thereby maintaining membrane integrity while facilitating directional phospholipid transport .

What are the optimal experimental designs for studying the kinetics of mlaE-mediated phospholipid transport?

Designing rigorous experiments to characterize the kinetics of mlaE-mediated phospholipid transport requires careful consideration of multiple experimental variables and appropriate controls. The following experimental design framework is recommended:

Reconstitution Systems:

  • Proteoliposomes containing purified, functionally reconstituted mlaE or complete MlaFEDB complex

  • Nanodiscs incorporating mlaE in a defined lipid environment

  • Giant unilamellar vesicles (GUVs) for single-vesicle transport assays

Kinetic Measurement Approaches:

  • Fluorescently labeled phospholipid transport assays

    • Use NBD or BODIPY-labeled phospholipids as transport substrates

    • Monitor fluorescence changes upon translocation between membrane leaflets

    • Apply dithionite quenching to distinguish inner and outer leaflet populations

  • Radioactive transport assays

    • Employ 14C or 3H-labeled phospholipids

    • Measure accumulation rates in vesicles or cells

    • Use rapid filtration to separate transported from non-transported molecules

Experimental Variables to Control:

  • Temperature (maintain at physiological 37°C)

  • pH (typically 7.2-7.4)

  • Ionic strength and buffer composition

  • ATP concentration (0-5 mM range)

  • Phospholipid composition in the membrane

Data Analysis:

  • Apply Michaelis-Menten kinetics to determine Km and Vmax parameters

  • Use progress curve analysis for complex transport mechanisms

  • Employ global fitting of data sets under varying conditions

This experimental design should include appropriate statistical controls and follow the principles of validity, reliability, and replicability as outlined in standard experimental design methodologies . Multiple approaches for determining the set of design points should be considered to ensure statistically optimal conditions given available resources .

How can cryo-EM methodologies be optimized for high-resolution structural analysis of mlaE in the MlaFEDB complex?

High-resolution structural characterization of mlaE within the MlaFEDB complex using cryo-EM requires optimization at multiple stages of the workflow:

Sample Preparation Optimization:

  • Protein purification

    • Ensure high purity (>95%) and homogeneity

    • Select detergents or nanodiscs that maintain native structure

    • Consider GraFix method to stabilize the complex

  • Grid preparation

    • Test multiple grid types (Quantifoil, C-flat, UltrAuFoil)

    • Optimize blotting parameters (time, force, humidity)

    • Consider additives to prevent preferred orientation issues

    • Implement glow discharge or plasma cleaning protocols

Data Collection Strategy:

  • Microscope settings

    • Voltage: 300 kV for optimal resolution

    • Objective aperture selection for contrast enhancement

    • Energy filter settings to improve signal-to-noise ratio

  • Imaging parameters

    • Implement beam-induced motion correction

    • Optimize defocus range (-0.8 to -2.5 μm)

    • Determine optimal electron dose (40-60 e-/Å2)

Image Processing Workflow:

  • Particle selection

    • Automated picking with reference-free approaches

    • Implement 2D classification to remove poor particles

    • Employ 3D classification to identify conformational states

  • Refinement strategies

    • Apply CTF correction throughout processing

    • Implement Bayesian polishing for motion correction

    • Consider multi-body refinement for flexible regions

    • Apply local resolution filtering

Through these optimizations, researchers have been able to achieve high-quality cryo-EM maps of the nucleotide-free MlaFEDB complex that reveal bound phospholipids and identify critical binding determinants with side-chain detail resolution . This approach has enabled visualization of phospholipids inside the central cavity of MlaE in the outward-open conformation, providing crucial insights into the phospholipid transport mechanism .

What are the best approaches for functional reconstitution of mlaE in artificial membrane systems?

Successful functional reconstitution of mlaE protein in artificial membrane systems requires careful optimization of multiple parameters to ensure retention of native transport activity:

Liposome Reconstitution Protocol:

  • Preparation of lipid mixture

    • Use E. coli polar lipid extract or defined mixtures mimicking bacterial membranes

    • Incorporate phosphatidylethanolamine (70%), phosphatidylglycerol (20%), and cardiolipin (10%)

    • Dissolve lipids in chloroform and create thin films by evaporation

  • Proteoliposome formation

    • Hydrate lipid films in reconstitution buffer to form multilamellar vesicles

    • Subject to freeze-thaw cycles (5-10 cycles) for homogenization

    • Extrude through polycarbonate filters (100-400 nm) to create unilamellar vesicles

    • Add detergent-solubilized mlaE at protein:lipid ratios of 1:50 to 1:200 (w/w)

    • Remove detergent using Bio-Beads or dialysis

Nanodisc Assembly:

  • Prepare MSP (Membrane Scaffold Protein)

    • Use appropriate MSP variants based on desired disc size

    • MSP1D1 for ~10 nm discs or MSP1E3D1 for larger complexes

  • Assembly reaction

    • Mix purified mlaE, MSP, and lipids at optimized ratios

    • Incubate at 4°C for self-assembly

    • Remove detergent using Bio-Beads

    • Purify assembled nanodiscs by size exclusion chromatography

Functional Verification:

  • ATPase activity assays

    • Measure ATP hydrolysis rates using malachite green assay

    • Compare activities in different lipid environments

  • Phospholipid transport assays

    • Monitor fluorescent phospholipid translocation

    • Track phospholipid movement using dithionite quenching

These reconstitution approaches should be documented in detail to ensure method replicability, following established protocols for scientific reporting . The optimization of protein:lipid ratios and detergent removal kinetics are particularly critical parameters that influence the final orientation and activity of reconstituted mlaE.

How can mutagenesis studies be designed to identify critical residues in mlaE involved in phospholipid recognition and transport?

A comprehensive mutagenesis strategy to identify functional residues in mlaE should employ both targeted and random approaches, with careful experimental design to validate findings:

Site-Directed Mutagenesis Strategy:

  • Target selection

    • Focus on hydrophobic residues lining the translocation pathway

    • Identify conserved motifs across bacterial species

    • Target residues revealed by structural studies to interact with phospholipids

    • Consider charged residues at proposed entry/exit points

  • Mutation design

    • Conservative substitutions (e.g., Leu→Ile, Asp→Glu)

    • Charge reversals for electrostatic interactions (e.g., Lys→Glu)

    • Size changes (e.g., Ala→Trp) for steric analysis

    • Polarity alterations (e.g., Ser→Ala) for hydrogen bonding studies

Random Mutagenesis Approach:

  • Error-prone PCR to generate variant libraries

  • Saturation mutagenesis at selected positions

  • Development of appropriate selection/screening systems

Functional Analysis Framework:

  • In vivo complementation assays

    • Transform mlaE mutants into mlaE-knockout bacterial strains

    • Assess restoration of membrane integrity and phospholipid homeostasis

    • Evaluate growth characteristics under various stress conditions

  • In vitro transport assays

    • Measure phospholipid transport rates in reconstituted systems

    • Determine changes in substrate specificity

    • Assess ATP hydrolysis coupling efficiency

  • Structural impact assessment

    • Evaluate protein stability and folding

    • Analyze conformational changes using hydrogen-deuterium exchange

    • Perform molecular dynamics simulations to predict effects

Table 2 presents a classification of typical mutation effects on mlaE function:

Table 2. Classification of mutation effects on mlaE functional parameters.

Mutation CategoryTransport ActivityATP HydrolysisConformational ChangesPhospholipid Binding
Substrate binding siteReduced/Altered specificityMinimal effectMinimalSignificantly altered
Translocation pathwaySeverely reducedUncoupledRestrictedTrapped/No release
ATP coupling interfaceNormal binding, reduced transportReduced/AbolishedImpairedNormal initial binding
Dimerization interfaceAbolishedAbolishedDestabilizedReduced
Allosteric sitesVariable effectsVariable effectsAltered dynamicsMinimal direct effect

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.