Recombinant Probable polyprenol reductase (CBG09584)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Probable Polyprenol Reductase (CBG09584)

Recombinant probable polyprenol reductase (CBG09584) is an enzyme involved in the biosynthesis of dolichols from polyprenols. Dolichols play a crucial role in the process of N-linked glycosylation, which is essential for protein modification and function. Despite the importance of polyprenol reductases in biological systems, specific information on the recombinant form CBG09584 is limited. This article aims to provide an overview of polyprenol reductases and their relevance to biological processes, while highlighting the challenges in obtaining detailed data on CBG09584.

Role of Polyprenol Reductases

Polyprenol reductases are enzymes responsible for converting polyprenols into dolichols. This conversion is critical for the synthesis of dolichol phosphate, which serves as a carrier for carbohydrate groups during N-linked glycosylation of proteins . The most well-studied polyprenol reductase is SRD5A3, which has been identified as essential for this process in humans and other organisms .

Biological Significance

The biological significance of polyprenol reductases lies in their role in protein glycosylation. Glycosylation is a post-translational modification that affects protein stability, folding, and function. Defects in glycosylation pathways, including those involving dolichol metabolism, can lead to congenital disorders of glycosylation (CDGs) .

Research Findings

While specific research findings on recombinant probable polyprenol reductase (CBG09584) are not readily available, studies on related enzymes provide valuable insights into their functions and potential applications:

  • SRD5A3: This enzyme is known to reduce the terminal double bond of polyprenols to form dolichols, which are crucial for N-linked glycosylation .

  • Congenital Disorders of Glycosylation (CDGs): Polyprenol reductase defects can lead to CDGs, highlighting the importance of these enzymes in human health .

Data Tables

Given the lack of specific data on CBG09584, the following table summarizes general information about polyprenol reductases and their biological roles:

Enzyme/CompoundFunctionBiological Role
Polyprenol ReductaseConverts polyprenols to dolicholsEssential for N-linked glycosylation
SRD5A3Reduces terminal double bond of polyprenolsCritical for dolichol synthesis and glycosylation
DolicholsServe as carriers for carbohydrate groupsInvolved in protein modification and stability

Challenges and Future Directions

The primary challenge in studying recombinant probable polyprenol reductase (CBG09584) is the scarcity of specific research data. Future studies should focus on characterizing this enzyme's structure, function, and potential applications in biotechnology and medicine. Understanding its role in glycosylation pathways could provide insights into treating congenital disorders related to dolichol metabolism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
CBG09584; Polyprenol reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
CBG09584
Target Protein Sequence
MLENLWEVRQALPIYLLTATIGLAVSCCFTLICPHVCRLIPALTTYGKAADQLEENSLVA RISVPKKWFKHFYALGLLTLLLCLHCIHSLIHNPDFLPTIPIKFLTILTRSYSIPPIAPS TAVLALLLITFHVARRLYETLFVSVYSDSRMNVFHYIVGIVHYIILPISIMCETQGVITK KEIFHVSVDDITLTQWAGAVLFWVCNWKQHQIAEQIANTRKGPRGLIRNYAYGICFGRWF NLVSCPHFLFEICIYLSLLLVIPTAYVYRFVVLFVCVNQTFAALITHSWYHKTFPKYPKT RKALIPYVL
Uniprot No.

Target Background

Function
This protein plays a pivotal role in the early stages of protein N-linked glycosylation. It is essential for the conversion of polyprenol into dolichol. Dolichols are crucial for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used in N-glycosylation. It functions as a polyprenol reductase, catalyzing the reduction of the alpha-isoprene unit of polyprenols into dolichols via a NADP-dependent mechanism.
Database Links

KEGG: cbr:CBG09584

STRING: 6238.CBG09584

Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is polyprenol reductase and what function does it serve in cellular biology?

Polyprenol reductase catalyzes the conversion of polyprenol to dolichol by reducing the α-terminal isoprene unit. This enzymatic reaction represents a critical step in dolichol biosynthesis, which is essential for protein glycosylation pathways. Dolichol serves as a lipid carrier during N-glycosylation, where oligosaccharides are assembled on dolichyl diphosphate (Glc₃Man₉GlcNAc₂-PP-Dol) before being transferred to asparagine residues in growing polypeptide chains. Additionally, the activated monosaccharides Dol-P-Man and Dol-P-Glc participate in protein N-glycosylation, O- and C-mannosylation, and glycosylphosphatidylinositol (GPI) anchor biosynthesis . Defects in this conversion pathway lead to abnormal glycosylation patterns that can manifest as Congenital Disorders of Glycosylation (CDG) in humans, emphasizing the fundamental importance of this enzyme in cellular function .

What expression systems are most effective for producing recombinant polyprenol reductase (CBG09584)?

For recombinant expression of CBG09584, bacterial expression systems have been successfully employed to produce functional enzyme for in vitro assays, as demonstrated with other polyprenol reductases . When expressing CBG09584, researchers should consider:

  • Using E. coli BL21(DE3) or similar strains optimized for membrane protein expression

  • Employing a vector system that includes a removable tag (His, GST, or MBP) for purification

  • Optimizing growth conditions: typically lower temperatures (16-20°C) after induction to facilitate proper folding

  • Addition of glycerol (10-20%) in lysis and storage buffers to maintain protein stability

The expressed protein should be stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, minimizing freeze-thaw cycles that can reduce enzymatic activity . Expression in yeast systems has also been successful for functional complementation studies of polyprenol reductases, which allows for in vivo assessment of enzymatic activity in a eukaryotic environment .

What are the optimal conditions for enzymatic activity assessment of recombinant polyprenol reductase?

Optimal conditions for assessing CBG09584 enzymatic activity include:

ParameterOptimal Condition
pH7.0-7.5
Temperature25-30°C
CofactorNADPH (required)
SubstratePolyprenol (C55-C95 depending on species)
BufferTypically Tris-HCl (50-100 mM)
AdditivesMg²⁺ (1-5 mM), reducing agent (DTT or β-mercaptoethanol)
Detection methodHPLC/UV, mass spectrometry for product identification

In vitro assays typically involve incubating the purified enzyme with polyprenol substrate and NADPH cofactor, followed by extraction of lipids and analysis by HPLC or mass spectrometry to quantify the conversion of polyprenol to dolichol . Recent studies have revealed that the traditional understanding of polyprenol reductases may need revision, as some enzymes previously characterized as direct polyprenol reductases may actually catalyze different steps in the pathway .

How do mutations in the conserved domains of polyprenol reductase affect its catalytic activity?

Mutations in conserved domains of polyprenol reductases significantly impact catalytic activity, with the C-terminal region being particularly critical. Studies with plant PPRD2 revealed that histidine residues in the C-terminal domain are important for catalytic function. Specifically, mutations H321L and H336L in plant PPRD2 resulted in approximately 47% and 45% reduction in enzymatic activity, respectively . These findings align with research on human SRD5A3, where the H296G substitution completely abolished enzymatic activity .

Complete truncation of the C-terminal domain, as demonstrated with plant PPRD1-INT3 and PPRD1-INT4 (missing 86 and 53 C-terminal amino acids, respectively), resulted in total loss of function . This underscores the essential nature of the C-terminal region for catalytic activity.

For researchers investigating CBG09584, site-directed mutagenesis of conserved histidine residues would be a strategic approach to map the catalytic site. Complementation assays in deletion mutants (such as yeast dfg10Δ) provide a functional readout for such mutations, assessed through restoration of protein glycosylation patterns .

What is the evolutionary relationship between CBG09584 and other polyprenol reductases across species?

Polyprenol reductases show evolutionary conservation across eukaryotes, from yeasts to plants and animals. Key evolutionary relationships include:

SpeciesEnzymeSimilarity to CBG09584Functional Conservation
HumanSRD5A3~45-55%Shared function in dolichol synthesis
YeastDfg10~40-47%Functional homology demonstrated by complementation
ArabidopsisPPRD1/PPRD2~40-50%Similar catalytic mechanism
PlasmodiumPfPPRD~35-45%Conserved function in dolichol synthesis

Evolutionary analysis indicates that while the core catalytic function is conserved, species-specific adaptations have occurred. For instance, Arabidopsis contains multiple PPRD genes (PPRD1, PPRD2, PPRD3) with PPRD2 being essential for viability, suggesting functional specialization . Cross-species complementation experiments have demonstrated functional conservation, as evidenced by Plasmodium falciparum PPRD rescuing glycosylation defects in yeast dfg10Δ mutants .

How does polyprenol reductase deficiency affect cellular glycosylation patterns and what are the downstream consequences?

Polyprenol reductase deficiency profoundly disrupts cellular glycosylation patterns with cascading effects on cellular function. The primary biochemical consequence is abnormal accumulation of polyprenol at the expense of dolichol. Recent metabolomic analyses reveal more complex changes:

MetaboliteChange in Deficient CellsFold Change
DolicholDecreased2-6 fold reduction
PolyprenolIncreased20-70 fold increase
PolyprenalIncreased (in SRD5A3 KO)85-fold increase
Polyprenoic acidIncreased (in SRD5A3 KO)10-fold increase

The consequences of these metabolic shifts include:

  • Underglycosylation of proteins due to insufficient dolichol-linked oligosaccharide precursors

  • Accumulation of hypoglycosylated protein forms with altered function and stability

  • Activation of ER stress responses and unfolded protein response pathways

  • Potential disruption of membrane properties due to altered polyisoprenoid composition

In yeast models, deletion of DFG10 (polyprenol reductase) results in underglycosylation of carboxypeptidase Y (CPY), with multiple glycoforms visible by western blot analysis . In human patients with SRD5A3 mutations, manifestations include multisystem developmental abnormalities consistent with Congenital Disorders of Glycosylation (CDG) .

Recent research indicates that the traditional view of SRD5A3 as a direct polyprenol reductase may be incomplete. Evidence suggests that DHRSX and SRD5A3 may act sequentially, with DHRSX converting polyprenol to polyprenal, followed by SRD5A3 reducing the C2-C3 double bond of polyprenal to produce dolichal, which is further reduced to dolichol .

What methodological approaches best elucidate the in vivo function of polyprenol reductase in model organisms?

Elucidating the in vivo function of polyprenol reductase requires multiple complementary approaches:

  • Genetic Manipulation Techniques:

    • CRISPR/Cas9 for precise gene editing in model organisms

    • Conditional knockdown systems (e.g., TetR-DOZI system in Plasmodium) to study essential genes

    • Tissue-specific or inducible knockout systems to overcome embryonic lethality issues

  • Metabolic Profiling:

    • Isotope labeling with [1-¹³C]glucose or [3-¹³C]IPP to track de novo biosynthesis of polyisoprenoid alcohols

    • LC-MS/MS analysis of polyisoprenoid profiles (polyprenol, dolichol, polyprenal, dolichal)

    • Quantification of dolichol-linked oligosaccharides

  • Functional Readouts:

    • Glycoprotein analysis using lectins or glycan-specific antibodies

    • SDS-PAGE mobility shift assays to detect hypoglycosylated protein forms

    • Complementation assays in yeast or other model organisms

A particularly informative approach demonstrated in research on Plasmodium falciparum involved metabolic labeling with [1-¹³C]glucose, which is metabolized via the MEP pathway to produce [1,5-¹³C]IPP and subsequently incorporated into polyisoprenoid alcohols. This approach confirmed de novo biosynthesis of polyprenols and dolichols of 15-19 isoprene units by the parasite .

For functional studies, the yeast complementation system using dfg10Δ mutants provides a robust platform. Expression of CBG09584 in this system, followed by analysis of carboxypeptidase Y glycosylation status, would provide direct evidence of functional conservation .

What are the current controversies regarding the exact catalytic mechanism of polyprenol reductases?

Recent research has challenged the traditional view of the catalytic role of SRD5A3 and related polyprenol reductases, revealing significant controversies:

To resolve these controversies, researchers should employ:

  • Biochemical assays with purified enzymes and defined substrates (polyprenol, polyprenal)

  • Comprehensive metabolomic profiling of polyisoprenoid intermediates

  • Structural studies of enzyme-substrate complexes

  • Multi-enzyme reconstitution experiments to clarify sequential actions

What are the best strategies for purifying active recombinant polyprenol reductase (CBG09584)?

Purifying active CBG09584 requires careful consideration of its membrane-associated nature. The optimal purification strategy includes:

  • Expression System Selection:

    • E. coli with membrane protein-optimized strains (C41/C43)

    • Alternative eukaryotic systems (insect cells, yeast) if functional protein is not obtained in bacteria

  • Solubilization Protocol:

    • Gentle detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS at concentrations just above CMC

    • Addition of glycerol (10-20%) and reducing agents to maintain stability

    • Brief sonication or homogenization followed by selective extraction

  • Purification Steps:

    • Immobilized metal affinity chromatography (IMAC) using histidine tag

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography as a polishing step

  • Activity Preservation:

    • Maintain reducing conditions throughout purification

    • Include NADPH in buffers where possible

    • Avoid freeze-thaw cycles; store small aliquots

    • Consider protein stabilization with lipid nanodiscs for long-term storage

For activity assays, the purified enzyme should be tested using polyprenol substrate and NADPH, with product formation monitored by HPLC/UV or mass spectrometry. Based on knowledge of other polyprenol reductases, the C-terminal domain is likely critical for catalytic activity, so care should be taken to avoid proteolytic degradation of this region during purification .

How can researchers effectively design experiments to resolve contradictions in polyprenol reductase catalytic models?

To resolve contradictions in polyprenol reductase catalytic models, researchers should implement a multi-faceted experimental approach:

  • Direct Enzyme Assays with Multiple Potential Substrates:

    • Purify recombinant CBG09584 and test activity with polyprenol, polyprenal, and other potential intermediates

    • Monitor NADPH consumption rates with different substrates

    • Identify reaction products using LC-MS/MS to determine exact catalytic function

  • Reconstitution of the Complete Pathway:

    • Co-express multiple enzymes (e.g., DHRSX and SRD5A3 homologs) to test sequential action hypothesis

    • Use isotope-labeled substrates to track conversion through multiple steps

    • Analyze intermediate accumulation in single vs. multi-enzyme systems

  • Structural Biology Approaches:

    • Obtain crystal structures or cryo-EM models of CBG09584 with substrate analogs

    • Perform molecular docking studies to predict substrate binding modes

    • Use hydrogen-deuterium exchange mass spectrometry to map conformational changes upon substrate binding

  • Genetic Complementation with Specific Pathway Intermediates:

    • Create knockouts for multiple pathway enzymes

    • Test rescue of phenotypes with different metabolic intermediates

    • Perform epistasis analysis with double knockouts

A promising experimental design would involve expressing CBG09584 in yeast dfg10Δ mutants that also have the DHRSX homolog deleted, then testing complementation with different combinations of genes and metabolic intermediates. Researchers could also employ metabolic labeling with isotope-traced precursors to follow the exact pathway of conversion in vivo, similar to the approach used in Plasmodium studies .

What considerations are important when designing CRISPR/Cas9 knockdown systems for studying essential polyprenol reductases?

Designing effective CRISPR/Cas9 knockdown systems for essential polyprenol reductases requires careful planning:

  • Conditional System Selection:

    • TetR-DOZI conditional system for translational repression, as attempted with PfPPRD

    • Auxin-inducible degron (AID) system for controlled protein degradation

    • Tet-On/Off systems for transcriptional control

  • Guide RNA Design Considerations:

    • Target catalytic domains identified through sequence conservation analysis

    • Avoid regions involved in protein-protein interactions if studying complex formation

    • Design multiple gRNAs to account for potential failures

    • Consider codon optimization based on the model organism

  • Phenotypic Readouts:

    • Polyisoprenoid alcohol profiles measured by HPLC or LC-MS

    • Glycoprotein analysis using lectins or glycan-specific antibodies

    • Growth phenotypes under different conditions

    • Cellular stress markers (e.g., ER stress indicators)

  • Validation Strategies:

    • Complementation with wild-type gene to confirm specificity

    • Rescue experiments with metabolic intermediates

    • Quantitative assessment of knockdown efficiency at protein level

    • Time-course analysis to distinguish primary from secondary effects

When studying essential genes like polyprenol reductases, researchers should be aware that complete knockout may be lethal, as observed with PPRD2 in Arabidopsis and predicted for PfPPRD in Plasmodium . In such cases, careful titration of knockdown efficiency or the use of rapid induction systems can help distinguish direct enzyme functions from secondary effects of cell death.

What are the best practices for analyzing polyisoprenoid profiles in biological samples?

Analyzing polyisoprenoid profiles requires specialized approaches due to their hydrophobic nature and structural similarities. Best practices include:

  • Sample Preparation:

    • Extract total lipids using chloroform-methanol mixtures (e.g., Bligh-Dyer method)

    • Perform alkaline hydrolysis to remove phospholipids

    • Use solid-phase extraction for pre-fractionation

    • Consider hydrofluoric acid treatment to remove phosphate groups from dolichyl phosphates

  • Analytical Methods:

    • Reverse-phase HPLC with UV detection (210-215 nm)

    • LC-MS/MS for improved sensitivity and structural confirmation

    • Gas chromatography for shorter chain polyisoprenoids after derivatization

    • Consider ion-mobility MS for isomer separation

  • Quantification Approaches:

    • Use internal standards (e.g., C80-polyprenol) for accurate quantification

    • Calculate dolichol:polyprenol ratios as indicators of enzyme activity

    • Generate standard curves with authenticated standards

    • Report chain-length distribution patterns

  • Data Interpretation:

    • Compare polyisoprenoid profiles across different conditions or genotypes

    • Calculate fold-changes for individual species and total pools

    • Consider ratios of pathway intermediates (polyprenol:dolichol, polyprenal:dolichal)

    • Correlate with functional outcomes (e.g., glycosylation efficiency)

When analyzing metabolic labeling experiments, researchers should look for isotopic enrichment patterns that follow a Gaussian distribution, as observed in Plasmodium studies with [1-¹³C]glucose and [3-¹³C]IPP . The chain-length distribution and degree of saturation provide important insights into the activity of the polyisoprenoid pathway enzymes.

How can researchers differentiate between direct and indirect effects of polyprenol reductase dysfunction in complex biological systems?

Differentiating direct from indirect effects of polyprenol reductase dysfunction requires systematic approaches:

  • Temporal Analysis:

    • Use time-course experiments with inducible knockdown systems

    • Monitor metabolite changes and correlate with onset of phenotypes

    • Early changes (minutes to hours) likely represent direct effects

    • Late changes (days) may reflect compensatory or secondary pathways

  • Metabolic Rescue Experiments:

    • Supplement with pathway intermediates (dolichol, dolichol phosphate)

    • Test whether glycosylation defects can be rescued without enzyme function

    • Use lipid carriers that bypass the need for endogenous dolichol

  • Multi-omics Integration:

    • Combine metabolomics, proteomics, and transcriptomics data

    • Use pathway enrichment analysis to identify affected processes

    • Apply causal network analysis to establish directionality

  • Comparative Studies Across Models:

    • Compare phenotypes in different cell types or organisms

    • Context-dependent changes may indicate indirect effects

    • Conserved changes across models suggest direct mechanisms

  • Genetic Interaction Studies:

    • Perform epistasis analysis with genes in related pathways

    • Use double knockdowns to test for synthetic interactions

    • Apply chemical genetics with pathway inhibitors

A useful approach demonstrated in research includes comparing the effects of DHRSX and SRD5A3 deficiency, which showed distinct metabolic profiles despite both affecting dolichol levels. SRD5A3-deficient cells uniquely accumulated polyprenal and polyprenoic acid, while both showed polyprenol accumulation, suggesting sequential rather than redundant roles .

What statistical approaches are most appropriate for analyzing polyprenol reductase activity data from in vitro and in vivo experiments?

Appropriate statistical approaches for polyprenol reductase activity data depend on experimental design and data characteristics:

  • In Vitro Enzyme Kinetics:

    • Nonlinear regression for Michaelis-Menten kinetics determination

    • Analysis of variance (ANOVA) with post-hoc tests for comparing activity across conditions

    • Principal component analysis for multi-substrate comparisons

    • Bootstrapping methods for robust confidence interval estimation

  • Metabolomic Data Analysis:

    • Log transformation of fold-change data to normalize distributions

    • Mixed-effects models for time-course experiments

    • False discovery rate correction for multiple comparisons

    • Partial least squares discriminant analysis for pattern recognition

  • Complementation Assay Analysis:

    • Categorical analysis for rescue/no rescue outcomes

    • Quantitative image analysis for glycoprotein band intensity

    • Hierarchical clustering for comparing multiple mutant phenotypes

    • Correlation analysis between enzyme activity and phenotype severity

  • In Vivo Studies:

    • Survival analysis for growth or viability phenotypes

    • Repeated measures ANOVA for longitudinal studies

    • Power analysis to determine appropriate sample sizes

    • Bayesian approaches for integrating prior knowledge with experimental data

When analyzing isotope labeling experiments, researchers should consider the isotopic dilution effects and employ mathematical modeling to account for the Gaussian distribution of labeled species, as observed in metabolic labeling studies with [1-¹³C]glucose in Plasmodium . For complementation studies in yeast, quantitative analysis of glycoprotein band patterns (e.g., CPY glycoforms) provides a robust readout of enzyme functionality .

What emerging technologies could advance our understanding of polyprenol reductase function and regulation?

Several emerging technologies hold promise for advancing polyprenol reductase research:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of membrane-associated polyprenol reductases

    • Visualization of enzyme-substrate complexes in near-native states

    • Structural insights into multi-enzyme complexes in the dolichol synthesis pathway

  • Single-Cell Metabolomics:

    • Analysis of cell-to-cell variation in polyisoprenoid profiles

    • Correlation with glycosylation efficiency at single-cell level

    • Detection of metabolic heterogeneity in tissues or cultures

  • Genome-Wide CRISPR Screens:

    • Identification of synthetic lethal interactions with polyprenol reductase

    • Discovery of compensatory pathways activated in deficiency states

    • Systematic characterization of genes affecting dolichol metabolism

  • Protein Engineering Approaches:

    • Directed evolution to enhance catalytic efficiency or substrate specificity

    • Development of split-protein biosensors for real-time monitoring of enzyme activity

    • Creation of optogenetic tools for spatial and temporal control of enzyme function

  • Advanced Computational Methods:

    • Molecular dynamics simulations of substrate binding and catalysis

    • Machine learning approaches to predict functional consequences of mutations

    • Systems biology modeling of the entire dolichol-dependent glycosylation pathway

These technologies could help resolve the current controversies regarding the exact catalytic role of polyprenol reductases and potentially identify novel therapeutic approaches for Congenital Disorders of Glycosylation related to dolichol metabolism .

What potential therapeutic applications might emerge from in-depth understanding of polyprenol reductase mechanisms?

In-depth understanding of polyprenol reductase mechanisms could lead to several therapeutic applications:

  • Congenital Disorders of Glycosylation (CDG) Treatments:

    • Small molecule chaperones to stabilize mutant polyprenol reductases

    • Development of substrate analogs that can bypass defective enzymes

    • Gene therapy approaches for severe enzymatic deficiencies

  • Antimicrobial Drug Development:

    • Species-specific inhibitors targeting pathogen polyprenol reductases

    • Drugs that exploit structural differences between human and microbial enzymes

    • Combination therapies targeting multiple steps in dolichol synthesis

  • Cancer Therapeutics:

    • Modulators of dolichol metabolism to alter cancer cell glycosylation patterns

    • Targeting increased dolichol requirements in rapidly dividing cells

    • Biomarkers based on altered polyisoprenoid profiles in cancer tissues

  • Neurodegenerative Disease Interventions:

    • Therapies addressing altered dolichol metabolism in aging and neurodegeneration

    • Compounds enhancing dolichol production to improve protein quality control

    • Targeted approaches to reduce polyisoprenoid-related oxidative stress

  • Metabolic Engineering Applications:

    • Enhanced production of glycosylated biotherapeutics through dolichol pathway optimization

    • Development of cell lines with expanded glycosylation capacity

    • Synthetic biology approaches incorporating modified polyisoprenoid pathways

The essential nature of polyprenol reductases for cell viability, as demonstrated by the lethality of PPRD2 knockout in Arabidopsis and predicted essentiality of PfPPRD in Plasmodium , highlights their potential as drug targets, particularly for antimicrobial development. Understanding the specific catalytic mechanisms and structural features will be crucial for designing selective inhibitors or activators with therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.