Recombinant Probable polyprenol reductase (B0024.13)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Processes

B0024.13 is essential for:

  • N-linked Glycosylation: Converts polyprenol to dolichol, a lipid required for oligosaccharide precursor synthesis .

  • Lysosome Dynamics: RNAi knockdown of B0024.13 in C. elegans reduces lysosome stores, impairing invasive protrusion formation during basement membrane (BM) breaching .

  • Protein Prenylation: Collaborates with prenylation pathways to localize GTPases (e.g., CED-10) to invasive membranes .

Research Applications and Findings

B0024.13 has been studied in C. elegans anchor cell (AC) invasion models to elucidate its role in developmental and pathological processes:

Experimental ApproachKey FindingsSource
RNAi KnockdownReduced lysosome stores; impaired AC invasion and BM breaching
Localization StudiesPolyprenol reductase activity linked to ER and peroxisomes at invasive fronts
Therapeutic RelevanceImplicated in congenital disorders of glycosylation (human homologs)

Mechanistic Insights:

  • Lipid Metabolism: B0024.13-derived dolichol supports sphingomyelin synthesis via SMS-1, facilitating lipid raft formation and matrix metalloproteinase (ZMP-1) localization .

  • Polarization: HMGR-1 (mevalonate pathway) and ICMT-1 (prenylation) dynamically polarize to deliver prenylated GTPases to invasive protrusions .

Therapeutic and Biological Significance

While B0024.13 is a C. elegans protein, its human homolog (e.g., PORED_HUMAN) is linked to:

  • Congenital Disorders: Defects in glycosylation (e.g., Kahrizi syndrome) .

  • Cancer Research: Dysregulated lipid metabolism and prenylation drive invasive protrusion formation, a hallmark of metastatic cells .

Future Directions:

  • Drug Targeting: AI-driven models predict B0024.13 conformations for small-molecule inhibitor design .

  • Developmental Biology: Studies on SBP-1 (SREBP) regulation of B0024.13 in lipid-rich membrane dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
B0024.13; Polyprenol reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
B0024.13
Target Protein Sequence
MLDRLWEVRQALPLYLLVSTLGLAISCCFTLICPHVCRLIPALTTYGKAADQQEDNSLVE KISVPKKWFKHFYAIGLLTLFICLHTVHSLIYNPNYLHPVVLKILATLTRSYSIPPITPS TSILALLLISLHVARRLYETIFVSVYSDSRMNLFHYAVGIVHYIILPISIMCETQGVASK LPQLHVSIDDISLTQWAGAVLFWICNWKQHQLAEQIANTRKGPRGLIRNYAYGICFGGWF NLVSCPHFLFEICIYLSLFLVIPDAYVYRFIIMFVCINQTFAALITHSWYHKTFPKYPKS RKALIPYVL
Uniprot No.

Target Background

Function
Plays a key role in the early steps of protein N-linked glycosylation by being essential for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used in N-glycosylation. Functions as a polyprenol reductase that catalyzes the reduction of the alpha-isoprene unit of polyprenols into dolichols via a NADP-dependent mechanism.
Database Links

KEGG: cel:CELE_B0024.13

STRING: 6239.B0024.13

UniGene: Cel.9469

Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is polyprenol reductase (B0024.13) and what is its primary function?

Polyprenol reductase (B0024.13) catalyzes the conversion of polyprenol to dolichol, a critical step in dolichol biosynthesis. This enzyme belongs to a family orthologous to human SRD5A3 (steroid 5α reductase type 3) and yeast DFG10 proteins . The catalytic function is essential for proper protein glycosylation, as the conversion from polyprenol to dolichol is required for subsequent cellular processes .

How does B0024.13 relate to other characterized polyprenol reductases?

B0024.13 functions similarly to other characterized polyprenol reductases like PPRD1 and PPRD2 in Arabidopsis, which are orthologous to human SRD5A3. These enzymes share approximately 47-54% similarity and 28-30% identity with human orthologs, and 39-47% similarity and 26-27% identity with yeast orthologs . Multiple sequence alignment of plant PPRDs reveals at least eight highly conserved regions that are likely critical for enzymatic function .

What phenotypes result from B0024.13 deficiency?

Loss of B0024.13 function strongly perturbs anchor cell (AC) invasion and reduces lysosome stores . This indicates that the enzyme plays a crucial role in cellular processes requiring membrane dynamics and vesicular trafficking. The phenotypic consequences are consistent with findings in other organisms where polyprenol reductase deficiency leads to accumulation of polyprenols at the expense of dolichols, ultimately causing defective protein N-glycosylation .

What model organisms are suitable for studying B0024.13 function?

Research on polyprenol reductases has been conducted in various model organisms:

  • C. elegans: Used to study B0024.13 function in basement membrane invasion

  • Yeast: The dfg10Δ mutant serves as a complementation system to test polyprenol reductase activity

  • Arabidopsis: PPRD1 and PPRD2 have been characterized as plant orthologs

  • Mammalian cell systems: Studies on human SRD5A3 provide comparative insights

Each system offers unique advantages for investigating different aspects of polyprenol reductase function.

How does B0024.13 contribute to basement membrane invasion?

B0024.13 is crucial for the formation of specialized protrusions that invasive cells use to breach basement membrane (BM) matrix barriers. Research by Park et al. revealed that de novo lipid synthesis and a dynamic polarizing prenylation system are required to rapidly construct these invasive protrusions . The polyprenol reductase activity appears to be specifically necessary for this process, as RNAi-mediated loss of B0024.13 significantly disrupts AC invasion in C. elegans .

What is the relationship between B0024.13 and the broader prenylation pathway?

B0024.13 functions within a network of enzymes involved in prenylation. Research indicates that RNAi-mediated loss of prenyltransferases (fnta-1 and fntb-1) and isoprenylcysteine carboxylmethyltransferase (icmt-1, which catalyzes the last step of prenylation) also significantly disrupts AC invasion . This suggests a coordinated role of these enzymes in supporting cellular processes dependent on proper lipid modification.

How do structural features of polyprenol reductases affect their catalytic function?

The catalytic domain of polyprenol reductases appears to be located in the C-terminal region. Studies on PPRD2 showed that histidine residues (particularly His-321 and His-336) are important for catalytic activity, though not solely responsible since H321L and H321L H336L mutants retained 47% and 45% of wild-type activity, respectively . Complete loss of function was observed in C-terminally truncated PPRD1 proteins, further supporting the critical nature of this region .

What are the implications of cross-species complementation studies for B0024.13 research?

Complementation studies provide valuable insights into functional conservation. PPRD1 and PPRD2 from Arabidopsis almost completely rescued the yeast dfg10Δ mutant phenotype, restoring normal dolichol synthesis and reducing polyprenol accumulation . This suggests fundamental conservation of the catalytic mechanism across diverse species and offers researchers an approach to validate B0024.13 function by testing its ability to complement deficiencies in orthologous genes across species.

What techniques are effective for measuring polyprenol reductase activity?

Several methodological approaches can effectively measure polyprenol reductase activity:

  • HPLC/UV analysis: Measures the conversion of polyprenols to dolichols, as demonstrated in studies of PPRD1 and PPRD2

  • Yeast complementation assays: Functional enzyme activity can be assessed by the ability to rescue phenotypes in dfg10Δ or dfg10-100 yeast mutants

  • In vitro enzyme assays: Using recombinant proteins expressed in bacterial systems to catalyze the reduction of polyprenol to dolichol under controlled conditions

  • Polyprenol:Dolichol ratio analysis: Quantifying the relative abundance of substrate and product as an indicator of enzyme activity

How can researchers optimize expression and purification of recombinant B0024.13?

Based on studies with related enzymes, researchers should consider:

  • Expression system selection: Bacterial systems have been successfully used for related enzymes , but eukaryotic systems may provide advantages for proper folding

  • Codon optimization: Adapting the coding sequence to the expression host's codon usage

  • Fusion tags: Using appropriate tags (His, GST, MBP) to facilitate purification while minimizing impact on activity

  • Solubility enhancement: Optimizing temperature, inducer concentration, and buffer conditions

  • Membrane protein considerations: As B0024.13 likely associates with membranes, detergent screening may be necessary for extraction and purification

What are effective genetic manipulation approaches for studying B0024.13 function?

Effective genetic approaches for studying B0024.13 include:

  • RNAi: Successfully used to study B0024.13 function in C. elegans

  • CRISPR-Cas9 genome editing: For generating precise mutations or knockouts

  • Conditional expression systems: To study temporal requirements

  • Domain swapping: Between orthologs to identify functionally important regions

  • Site-directed mutagenesis: To test the importance of specific residues, such as histidines in the C-terminal region

How can researchers assess the impact of B0024.13 on cellular glycosylation?

To assess impacts on glycosylation, researchers should consider:

  • Glycoprotein analysis: Mass spectrometry to profile N-linked glycans

  • Lectin binding assays: To detect changes in cell surface glycosylation

  • Pulse-chase experiments: To track glycoprotein synthesis and processing

  • Glycosylation reporter systems: Using fluorescent proteins with N-glycosylation sites

  • Dolichol-linked oligosaccharide profiling: To detect precursor accumulation

How should researchers design experiments to distinguish between direct and indirect effects of B0024.13 inhibition?

To distinguish direct from indirect effects, researchers should implement:

  • Temporal analysis: Monitoring immediate versus delayed changes following inhibition

  • Rescue experiments: Testing whether reintroduction of functional B0024.13 restores normal phenotypes

  • Substrate/product supplementation: Determining if dolichol supplementation bypasses the requirement for B0024.13

  • Parallel inhibition studies: Comparing effects of B0024.13 inhibition with inhibition of other enzymes in the pathway

  • Domain-specific mutations: Creating variants that affect specific functions rather than eliminating the entire protein

What controls are necessary for in vitro studies of recombinant B0024.13?

Critical controls for in vitro studies include:

  • Enzyme-free reactions: To account for non-enzymatic conversion

  • Heat-inactivated enzyme: To distinguish enzymatic from non-specific effects

  • Wild-type vs. mutant enzymes: Using known mutations that affect activity, such as His→Leu substitutions

  • Substrate specificity controls: Testing structurally related but non-substrate compounds

  • Enzyme concentration gradients: To establish reaction linearity

  • Cofactor requirements: Testing dependence on specific cofactors

What approaches can effectively integrate B0024.13 research with broader cellular context?

For integrative research approaches, consider:

  • Multi-omics integration: Combining transcriptomics, proteomics, lipidomics, and glycomics

  • Pathway analysis: Examining effects on related prenylation pathways

  • Subcellular localization studies: Determining where B0024.13 functions within cells

  • Interactome mapping: Identifying protein-protein interactions

  • Model organism phenotyping: Assessing developmental, behavioral, or physiological impacts

How should researchers interpret polyprenol reductase activity data across different experimental systems?

When interpreting data across systems, researchers should:

  • Consider evolutionary context: Acknowledge that orthologs may have species-specific functions despite catalytic conservation

  • Normalize for expression levels: Account for variations in protein abundance

  • Standardize assay conditions: Use comparable substrate concentrations, pH, and temperature

  • Compare kinetic parameters: Evaluate Km, Vmax, and catalytic efficiency

  • Assess substrate specificity: Determine if orthologs have different preferences for polyprenol chain lengths

The following table presents a hypothetical comparison of polyprenol reductase activity across systems:

Enzyme SourceRelative Activity (%)Optimal pHTemperature Optimum (°C)Km for Polyprenol (μM)
B0024.13 (C. elegans)1007.22515
PPRD1 (Arabidopsis)857.03022
PPRD2 (Arabidopsis)926.82818
SRD5A3 (Human)757.43712
DFG10 (Yeast)806.53025

What statistical approaches are most appropriate for analyzing polyprenol reductase experimental data?

Appropriate statistical approaches include:

  • Enzyme kinetics modeling: Michaelis-Menten or Lineweaver-Burk analyses

  • ANOVA: For comparing activity across multiple conditions

  • Regression analysis: For exploring relationships between enzyme activity and phenotypic outcomes

  • Bootstrap methods: For robust confidence interval estimation with limited samples

  • Bayesian approaches: For integrating prior knowledge with experimental data

How can researchers distinguish effects specific to B0024.13 from general disruption of lipid metabolism?

To distinguish specific effects, researchers should:

  • Compare phenotypes: Between B0024.13 inhibition and inhibition of other prenylation enzymes

  • Conduct metabolite profiling: Measuring specific changes in polyprenol:dolichol ratios versus broader lipid alterations

  • Perform targeted rescue experiments: Testing whether dolichol supplementation specifically rescues B0024.13 deficiency

  • Use structure-function studies: With targeted mutations affecting specific aspects of B0024.13 activity

  • Employ temporal inhibition strategies: To identify primary versus secondary effects

How might B0024.13 research contribute to understanding demyelinating disorders?

Research on polyprenols has shown potential applications for demyelinating disorders:

  • Neuroprotective properties: Polyprenols isolated from Picea abies have demonstrated neuroprotective effects

  • Demyelination reduction: Polyprenol treatment has been tested for halting acute demyelination caused by cuprizone

  • Functional recovery: Polyprenols may help recover impaired glial and neuronal functions

In experimental models, polyprenol supplementation was tested in CD-1 mice exposed to cuprizone (0.5%) to induce demyelination . This approach may help understand how modulating the polyprenol:dolichol ratio affects myelination processes.

What potential exists for targeting B0024.13 or related enzymes in basement membrane invasion disorders?

Given B0024.13's role in basement membrane invasion , potential applications include:

  • Cancer metastasis: As invasive cells require specialized protrusions to breach basement membranes

  • Developmental disorders: Where inappropriate cell migration contributes to pathology

  • Wound healing: Where controlled basement membrane remodeling is necessary

Research shows that de novo lipid synthesis and polarized prenylation drives cell invasion through basement membrane , suggesting that targeted modulation of B0024.13 activity could potentially regulate invasive cell behaviors.

How do age-related changes in polyprenol metabolism affect biological systems?

Research on age-related aspects of polyprenol metabolism suggests:

  • Altered ratios: Age-dependent changes in polyprenol:dolichol ratios may affect glycosylation efficiency

  • Cognitive implications: Proper glycosylation is important for neural function, with potential relevance to age-related cognitive changes

  • Monitoring capacity: Despite age-related changes in learning, the monitoring of learning appears to be maintained across the adult life span

Studies comparing adults across the lifespan (18-80 years) demonstrate that while associative learning declines with age, metacognitive monitoring abilities remain largely intact , suggesting complex relationships between age-related biochemical changes and functional outcomes.

What emerging technologies show promise for advancing B0024.13 research?

Promising technologies include:

  • Cryo-EM: For determining high-resolution structures of B0024.13 and substrate complexes

  • Single-molecule enzymology: To understand dynamic aspects of enzyme function

  • Optogenetic control: For spatiotemporal regulation of enzyme activity

  • Organoid models: For studying tissue-specific functions in complex cellular environments

  • Computational modeling: For predicting effects of mutations and designing specific inhibitors

What unexplored aspects of B0024.13 function warrant investigation?

Key areas for future investigation include:

  • Regulatory mechanisms: How B0024.13 activity is controlled in response to cellular needs

  • Tissue-specific functions: Whether the enzyme has specialized roles in different tissues

  • Interactions with membrane environments: How lipid composition affects enzyme activity

  • Evolutionary adaptations: Species-specific features that have evolved in different organisms

  • Alternative substrates: Whether B0024.13 can act on molecules beyond canonical polyprenols

How might understanding B0024.13 inform broader questions about lipid-dependent cellular processes?

B0024.13 research can inform understanding of:

  • Membrane organization: How dolichol-dependent processes contribute to membrane domain formation

  • Protein trafficking: The role of glycosylation in determining protein fate

  • Cell invasion mechanisms: How lipid modifications enable specialized cellular behaviors

  • Evolutionary conservation: How fundamental lipid modification pathways have been maintained across species

  • Disease mechanisms: Connecting specific enzymatic defects to complex cellular phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.