Recombinant Probable protease sohB (sohB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Probable Protease SohB (SohB)

The Escherichia coli sohB gene encodes a periplasmic protease . Overexpression of the E. coli sohB gene can compensate for a missing HtrA protein . The sohB gene maps to 28 min on the E. coli chromosome, located precisely between the topA and btuR genes .

Functional Analysis

The E. coli HtrA protein is a periplasmic protease necessary for bacterial viability above 39 degrees C . Overexpression of the sohB gene can relieve the temperature-sensitive phenotype of bacteria with a Tn10 insertion in the htrA (degP) gene, which suggests that the sohB gene encodes a previously undiscovered periplasmic protease in E. coli .

Recombinant Expression and Purification

To tightly control the expression of recombinant proteins, E. coli strain BL21(DE3) pLysS and various expression vectors encoding fusion proteins can be used to enhance recombinant protein solubility . Fusion protein domains, such as maltose-binding protein (MBP), SP-MBP, disulfide oxidoreductase (DsbA), and Glutathione S-transferase (GST) can improve protease expression and solubility . Approximately 86.1% of cloned ORFs were expressed and purified with at least one of the expression vectors, and by batch purification, between 2-200 μg of recombinant proteins were obtained . The purity of the recombinant proteins, confirmed by Nu-PAGE gel analysis, ranged between 80-95% .

Proteolytic Activity Assays

Zymography and fluorescence-based assays can be performed to detect novel proteolytic activities . These assays confirmed the protease activities of more than 46% of purified proteases and 40% of hypothetical proteins predicted to be proteases .

SohB in Symbiotic Bacteria

A study identified nine S. symbiotica proteases with complete genomic information, including the putative peptidase SohB .

Applications of Proteases in Protein Processing

Kex2p can be used as an alternative endoprotease for the in vitro processing of recombinant fusion proteins .

Table: Antiproliferative Activity of Sample Compounds on Cancer Cell Lines

The below data details the antiproliferative activity of several compounds on HT-29, M21, and MCF7 cells :

CompoundHT-29 (IC50, μM)M21 (IC50, μM)MCF7 (IC50, μM)
PIB-SOsData variesData variesData varies
PPB-SOsData variesData variesData varies
CA-4Data variesData variesData varies
Compound 6Data variesData variesData varies

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notice and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sohB; Probable protease SohB; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Buchnera aphidicola subsp. Schlechtendalia chinensis
Target Names
sohB
Target Protein Sequence
MDFILNYALFFFKIFTLFALILTIFLIIVNVARHKSKKKYELDIVSLNSYYEHVKNKIIL STMSTYEKKIWNKSNKLFKKTRSKINMTFLKKNKYYLNQNNPILYVLDFKGNVSASEVTS LREEISAIILAAKENDEVLLRLESGGGVIHGYGLASSQLSRLREKNIRLTVSVDKIAASG GYMMACVANYIIAAPFSVIGSIGVVAQIPNFNKLLKKNNVDMELHTSGLYKRTLTVFGEN TKEAREKFCKDLNFTHVLFKEFVHSMRPSLNIDEVSTGEHWFGTTALEKKLIDKIETSDD FIISR
Uniprot No.

Target Background

Protein Families
Peptidase S49 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SohB and what is its biological function?

SohB is a periplasmic protease found in Escherichia coli that functions as a suppressor of the temperature-sensitive phenotype in bacteria carrying a Tn10 insertion in the htrA (degP) gene. The sohB gene encodes a 39,000-Mr precursor protein which is processed to a 37,000-Mr mature form with proteolytic activity. The predicted protein has homology with the inner membrane enzyme protease IV of E. coli, which digests cleaved signal peptides. When overexpressed (30-50 copies per cell), SohB can partially compensate for the missing HtrA protein function, which is required for bacterial viability at temperatures above 39°C . The mature SohB protein contains 327 amino acids (after processing of the 22-amino acid signal sequence) and has a molecular weight of approximately 37.5 kDa .

Where is the sohB gene located in the E. coli genome?

The sohB gene maps to 28 min on the E. coli chromosome, precisely between the topA and btuR genes . This genomic positioning is important for researchers designing knockout experiments or considering genomic context effects on expression. When performing genomic manipulations involving sohB, researchers should consider potential polar effects on adjacent genes.

What expression systems are optimal for recombinant SohB production?

Based on the available literature, several expression systems have been successfully used for recombinant protease expression, with varying advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsTypical Yield
Yeast ExpressionEconomical eukaryotic system; Post-translational modifications; High protein qualityModerate yieldVariable
E. coli BL21(DE3) pLysSTight control of expression; Reduces toxicityRequires optimization2-200 μg per batch purification
Mammalian Cell ExpressionVery high quality; Native-like structureLow yield; High cost; Complex culture conditionsLow

How can the toxicity issues associated with recombinant protease expression be mitigated?

Expressing proteases in heterologous hosts often presents toxicity challenges due to their catalytic functions. Several strategies can mitigate these issues:

  • Use of fusion proteins to improve solubility and reduce toxicity. Successful fusion partners include:

    • Maltose-binding protein (MBP)

    • MBP with signal peptide (SP-MBP)

    • Disulfide oxidoreductase (DsbA)

    • Glutathione S-transferase (GST)

  • Tight control of expression using:

    • BL21(DE3) pLysS strain where T7 lysozyme inhibits T7 RNA polymerase

    • Glucose supplementation to repress the lac promoter controlling T7 RNA polymerase expression

  • Signal peptide inclusion in fusion constructs (as in SP-MBP and DsbA vectors) can direct proteins to the periplasm, potentially reducing toxicity in the cytoplasm .

These approaches have demonstrated success with approximately 86.1% of protease genes being successfully expressed and purified using a combination of different expression vectors .

What is the relationship between SohB and HtrA (DegP) proteases?

The relationship between SohB and HtrA proteases represents an interesting case of functional complementation in bacterial stress response. SohB can partially compensate for HtrA deficiency when overexpressed, though the mechanisms differ:

CharacteristicSohBHtrA (DegP)
LocationPeriplasmicPeriplasmic
Size37 kDa (mature)46.5 kDa
Temperature requirementNot explicitly temperature-dependentRequired for viability above 39°C
Functional overlapCan partially compensate for HtrA when overexpressedCannot be fully replaced by SohB
Sequence homologyHomologous to protease IVMember of the HtrA family of serine proteases

What purification strategies are most effective for recombinant SohB?

For recombinant His-tagged SohB, the following purification protocol is recommended based on established methodologies for similar proteases:

  • Affinity chromatography using Ni-NTA resin:

    • Equilibrate column with binding buffer (typically 50 mM sodium phosphate, 300 mM NaCl, 10 mM imidazole, pH 8.0)

    • Apply cleared cell lysate

    • Wash with binding buffer containing 20-30 mM imidazole

    • Elute with elution buffer containing 250-300 mM imidazole

  • For high-throughput applications, batch purification using 2 mL 96-well filter blocks can yield between 2-200 μg of recombinant protein with 80-95% purity .

  • Further purification steps may include:

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography for removal of contaminating proteins

  • Confirm protein identity by:

    • SDS-PAGE analysis

    • In-gel trypsin digestion followed by MALDI-TOF/TOF analysis

How can SohB proteolytic activity be detected and characterized?

To detect and characterize SohB proteolytic activity, researchers can employ several complementary approaches:

  • Zymography:

    • Incorporate potential substrate proteins into polyacrylamide gels

    • After electrophoresis, incubate the gel in optimal reaction conditions

    • Proteolytic activity appears as clear zones in the stained gel

  • Fluorescence-based assays:

    • Use fluorogenic peptide substrates

    • Monitor release of fluorescent groups upon proteolysis

    • Enables kinetic analysis of proteolytic activity

  • Temperature-sensitivity complementation assay:

    • Transform htrA mutant E. coli strains with plasmids expressing SohB

    • Assess growth at elevated temperatures (above 39°C)

    • Successful complementation indicates functional SohB activity

  • Substrate specificity analysis:

    • Test cleavage of various peptide substrates

    • Identify preferred amino acid sequences at the cleavage site

    • Compare with known specificities of related proteases like protease IV

When characterizing novel proteases, it's recommended to use multiple detection methods as approximately 46% of purified proteases and 40% of hypothetical proteins predicted to be proteases can be confirmed using a combination of zymography and fluorescence-based assays .

What are the optimal conditions for SohB enzymatic activity?

While specific conditions for SohB activity are not explicitly detailed in the available literature, general considerations for periplasmic proteases can guide experimental design:

ParameterRecommended RangeNotes
pH6.0-8.0Typical optimal range for periplasmic proteases
Temperature25-37°CStandard range for E. coli proteins
Salt concentration50-300 mM NaClBuffer optimization recommended
CofactorsTest divalent cations (Ca²⁺, Mg²⁺, Zn²⁺)May enhance activity
Reducing agentsGenerally avoidPeriplasmic proteins may contain disulfide bonds

Activity assays should initially employ a range of conditions to determine the optimum. Given SohB's periplasmic localization, conditions mimicking the periplasmic environment (slightly acidic to neutral pH, oxidizing conditions) may be most physiologically relevant.

How does the structure of SohB relate to its function?

While the precise three-dimensional structure of SohB has not been detailed in the provided literature, some structure-function relationships can be inferred from its sequence homology with protease IV and other proteases:

  • Signal sequence (amino acids 1-22):

    • Directs the protein to the periplasm

    • Cleaved during export to yield the mature protein

  • Catalytic domain:

    • Likely contains a catalytic triad typical of serine proteases

    • Homology to protease IV suggests similar catalytic mechanism

  • Substrate binding pocket:

    • Specificity determinants must accommodate similar substrates to HtrA

    • May have a preference for hydrophobic residues based on homology to protease IV

Advanced structural studies such as X-ray crystallography or cryo-electron microscopy would be valuable to elucidate the precise structural features of SohB and how they relate to its function in protein quality control and stress response.

What is known about post-translational modifications of SohB?

The primary post-translational modification documented for SohB is the cleavage of its signal sequence between amino acids 22 and 23, reducing the size from the 39 kDa precursor to the 37 kDa mature form . When expressed in yeast systems, additional eukaryotic post-translational modifications may occur, including:

  • Glycosylation - addition of sugar moieties

  • Acylation - addition of fatty acid chains

  • Phosphorylation - addition of phosphate groups

These modifications can affect protein folding, stability, and activity. When using recombinant SohB for functional studies, researchers should consider how the expression system might influence post-translational modifications and consequently protein function. The yeast protein expression system offers advantages in producing protein with modifications that ensure native-like conformation .

What are common issues in recombinant SohB expression and how can they be resolved?

Researchers working with recombinant proteases including SohB frequently encounter several challenges:

ChallengePotential CausesSolutions
Low expression levelsToxicity to host cells; Protein instabilityUse tightly controlled expression systems; Add protease inhibitors; Express as fusion protein
Formation of inclusion bodiesImproper folding; OverexpressionLower induction temperature (16-25°C); Reduce inducer concentration; Use solubility-enhancing fusion tags (MBP, GST)
Loss of activity during purificationAutoproteolysis; Improper foldingInclude appropriate protease inhibitors; Optimize buffer conditions; Maintain cold temperatures during purification
Inconsistent activity assay resultsSubstrate variability; Cofactor requirementsStandardize substrate preparation; Test various cofactors; Optimize reaction conditions

For challenging proteins, a systematic approach testing multiple expression vectors and conditions is recommended. Success rates of approximately 86.1% have been achieved for protease expression using a combination of five different expression vectors with various fusion tags .

How can researchers distinguish between SohB activity and other proteases in experimental systems?

Distinguishing the specific activity of SohB from other proteases in experimental systems requires several control strategies:

  • Negative controls:

    • Use catalytically inactive SohB mutants

    • Compare with extract from cells expressing empty vector

    • Include specific inhibitors of other protease classes

  • Genetic approaches:

    • Express SohB in protease-deficient strains

    • Perform knockout/complementation experiments

    • Use defined genetic backgrounds

  • Biochemical verification:

    • Perform activity assays with purified protein

    • Analyze substrate specificity patterns

    • Use protease inhibitor panels to rule out contaminating activities

  • Complementation specificity:

    • Test whether the temperature-sensitive phenotype of htrA mutants is specifically rescued by SohB overexpression and not by control proteins

These approaches in combination provide stronger evidence for SohB-specific activity than any single method alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.