Recombinant Human papillomavirus type 16 Probable protein E5 (E5)

Shipped with Ice Packs
In Stock

Description

Functional Roles in HPV16 Pathogenesis

The E5 protein contributes to HPV16-driven oncogenesis through multiple mechanisms:

Immune Evasion

  • Downregulation of HLA-I Surface Expression: E5 forms a ternary complex with calnexin and HLA-I heavy chains, retaining HLA-I in the endoplasmic reticulum (ER) and reducing antigen presentation to cytotoxic T cells .

  • Disruption of MHC Class I Trafficking: This mechanism prevents immune detection of infected cells, critical for persistent infection .

Pro-Survival Signaling

  • Enhanced EGFR Activation: E5 stabilizes EGFR-ligand complexes, increasing receptor recycling and signaling through PI3K-Akt and ERK1/2 MAPK pathways .

  • Anti-Apoptotic Effects: Activation of Akt and ERK1/2 inhibits apoptosis in UV-irradiated keratinocytes, promoting cell survival under stress .

Cooperation with Viral Oncoproteins

  • Synergy with E6/E7: E5 enhances E6/E7-mediated immortalization by upregulating mitogenic signals and downregulating tumor suppressors like p21 .

Oncogenic Mechanisms

PathwayE5’s RoleExperimental Evidence
EGFR SignalingIncreases receptor recycling, enhances EGF-dependent activation Phosphorylation assays in primary keratinocytes
PI3K-AktActivates Akt, inhibiting apoptosis via BAD, caspase-9, and NF-κB Wortmannin (PI3K inhibitor) blocks E5’s survival effect
ERK1/2 MAPKAmplifies ERK1/2 activation, promoting cell proliferation PD98059 (ERK inhibitor) abrogates E5-mediated survival

Therapeutic Targeting

  • Vaccine Development: Recombinant E5 delivered via adenovirus vectors induces CD8+ T-cell responses, reducing tumor growth in HPV16-associated murine models .

  • Antigen Delivery: Conjugation of E5 to anti-DEC-205 antibodies enhances dendritic cell uptake, eliciting robust antitumor immunity .

Recombinant Production

The His-tagged E5 is produced in E. coli using codon-optimized sequences for high-yield expression. Key steps include:

  1. Expression: Grown in LB medium, induced with IPTG.

  2. Purification: Ni-NTA affinity chromatography followed by dialysis .

  3. Storage: Lyophilized at -20°C/-80°C to prevent degradation .

Experimental Uses

ApplicationMethodOutcome
Vaccine FormulationAdenovirus-delivered E5 or anti-DEC-205:E5 conjugates Induction of E5-specific CD8+ T cells
Immune Evasion StudiesCo-IP assays with calnexin and HLA-I Demonstration of E5-calnexin-HLA-I ternary complex
Apoptosis AssaysTUNEL staining in UV-irradiated keratinocytes Reduced apoptosis in E5-expressing cells

Critical Challenges and Future Directions

  1. E5’s Limited Role in Late-Stage Cancers: Deletions in the E5 gene are common in cervical cancers, suggesting its role is primarily in early infection .

  2. Therapeutic Resistance: Tumor cells may downregulate E5 expression to evade immune responses, necessitating combinatorial therapies .

  3. Structural Insights: Resolving E5’s trihelical conformation could inform drug design targeting its interactions with EGFR or calnexin .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any special requirement for the format, please remark your requirement when placing the order. We will prepare according to your demand.
Lead Time
Delivery time may differ based on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
E5; Probable protein E5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-83
Protein Length
full length protein
Species
Human papillomavirus type 16
Target Names
E5
Target Protein Sequence
MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCF IVYIIFVYIPLFLIHTHARFLIT
Uniprot No.

Target Background

Function
The protein acts to maintain host cells in a proliferation-competent state upon differentiation. It enhances host epidermal growth factor receptor (EGFR) activation after stimulation by EGF by inhibiting EGFR internalization. Additionally, it induces a redistribution of host caveolin-1 and glycosphingolipid (ganglioside GM1) components of lipid rafts to the plasma membrane. As GM1s inhibit cytotoxic T-lymphocytes, block immune synapse formation, and enhance proliferative signaling by the EGFR, E5 may enhance immune evasion and cell proliferation through a common mechanism. E5 also alters endosomal pH by interacting with the vacuolar H+-ATPase, a proton pump responsible for acidifying cellular organelles. Furthermore, E5 prevents the transport of major histocompatibility class I to the cell surface and retains the complex in the Golgi apparatus.
Gene References Into Functions
  1. HPV16 E5 is produced from an HPV16 early mRNA spliced from SD226 to SA3358. PMID: 29155138
  2. Research indicates that Human papillomavirus type 16 oncogene E5 is primarily responsible for Met upregulation; E5-induced Met contributes to the motility of HPV-containing cells. These studies reveal a new role for E5 in epithelial-stromal interactions, with implications for cancer development. PMID: 29609071
  3. A transcriptional crosstalk among 16E5 and KGFR might be the key molecular driver of epithelial deregulation during the initial stages of HPV infection and transformation. PMID: 25826082
  4. HPV16 early gene E5 specifically down-regulates miRNA196a in cervical cancer cell lines. PMID: 25563170
  5. Results demonstrate that HPV16 E5 down-modulates FGFR2b and induces FGFR2c expression in human keratinocytes and cervical epithelial cells through the down-modulation of ESRPs. PMID: 25450802
  6. Graphene nanoribbons elicit cell-specific uptake and delivery via activation of epidermal growth factor receptor enhanced by human papillomavirus E5 protein. PMID: 24980059
  7. Data suggest HPV16 E5 as a potential therapeutic target in cervical cancer. PMID: 24142729
  8. Human papillomavirus E5 oncoproteins bind to the A4 in the endoplasmic reticulum to regulate proliferative ability upon differentiation. PMID: 24606699
  9. This review examines the potential therapeutic role of HPV16 E5 as a target for cervical cancer. PMID: 22262402
  10. No definitive conclusion could be drawn regarding the correlation between E5 expression and disease progression in patients with squamous intra-epithelial lesions of the cervix. PMID: 21767984
  11. Both the annexin A2 and p11 subunits of calpactin I coimmunoprecipitate with human papillomavirus type 16 E5 in COS cells and in human epithelial cell lines. An intact E5 C terminus is required for binding. PMID: 21849434
  12. HPV infection and subsequent transformation occur through complex regulatory patterns of gene expression in host cells, some of which are regulated by the E5 protein. PMID: 21747943
  13. The authors demonstrate that human papillomavirus type 16 E5 protein expression itself stimulates IFN-beta expression. This stimulation is specifically mediated by the induction of interferon regulatory factor 1. PMID: 21389130
  14. 16E5 alters EGF endocytic trafficking via a pH-independent inhibition of vesicle fusion. PMID: 20686024
  15. CD1d is downregulated by the HPV16 E5 and HPV6 E5 protein. PMID: 20810727
  16. These data indicate that E5 represses the cellular endoplasmic reticulum stress response, suggesting a potential role for E5 during productive HPV infection. PMID: 20688044
  17. The authors demonstrate that the human papillomavirus 16 E5 protein-induced reduction of HLA-A2 has a functional impact by reducing recognition of E5 expressing cells by human papillomavirus-specific CD8+ T cells. PMID: 20813390
  18. HPV16 E5 produces polyploid cells and enlarged nuclei by endoreplication. These findings provide insight into how HPV16 E5 can contribute to cell transformation. PMID: 20605566
  19. 4075T is highly conserved in E5 of human papillomavirus type 16 isolated from Asia. PMID: 20718354
  20. HPV-16 E5 impaired the viability of trophoblastic and cervical cell lines. E5 & E6/E7 increase chemotaxic & invasive properties of trophoblastic cells. HPV-16 E5 participates, alongside E6 & E7, in these changes by impairing E-cadherin expression. PMID: 19917629
  21. HPV 16 E5 protein contributes to cervical carcinogenesis by inhibiting apoptosis of transformed cervical epithelial cells. PMID: 20015862
  22. E5 and the EGF-receptor cooperate to enhance cell cycle entry and progression through regulating p27(Kip1) expression at the protein level. PMID: 20144468
  23. Topology findings are compatible with a model of E5 being a 3-pass transmembrane protein, consistent with studies demonstrating its C terminus interacting with cytoplasmic proteins. PMID: 19955310
  24. The first hydrophobic domain of E5 is required for invasion of the cell matrix. PMID: 19812262
  25. The functions of the E5 protein are not mediated by morphological alterations in the actin cytoskeleton, microtubule network, or adhesion to the extracellular matrix. Colocalization of E5 with the Bcl-2 antiapoptotic protein on intracellular membranes was established. PMID: 15593417
  26. -16 E5 protein can form a complex with ErbB4 via binding to the extracellular and transmembrane domains of ErbB4 (JM-b/CYT-1). PMID: 16819515
  27. E5 can interfere with antigen presentation by most, if not all, classical HLA I haplotypes. PMID: 16823848
  28. Increases cell membrane expression of caveolin-1, induces a 23- to 40-fold increase in lipid raft component ganglioside GM1 at the cell membrane of E5-expressing uterine cervical cells, and mediates a dramatic increase in caveolin-1/GM1 association. PMID: 17704805
  29. HPV-16 E5 protein binds to karyopherin beta3. PMID: 18455505
  30. Results identify B-cell-associated protein 31 as a novel binding partner of the high-risk human papillomavirus 16 E5 proteins, providing insight into how the E5 proteins may modulate the life cycle in differentiating cells. PMID: 18684816
  31. Using biochemical and cell biological assays to gain a deeper understanding of HPV16 E5, the authors find that HPV16 E5 localizes to the plasma membrane with an intracellular amino terminus and an extracellular carboxyl-terminus. PMID: 19712955

Show More

Hide All

Database Links

KEGG: vg:1489077

Protein Families
Papillomaviridae E5 protein family
Subcellular Location
Host membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane. Host Golgi apparatus.

Q&A

What is the structural organization of HPV16 E5 protein?

HPV16 E5 is organized as a transmembrane protein with three putative transmembrane helices formed by interaction between the first and third hydrophobic segments. The protein's hydrophobic profile is critical for its function and cellular localization. Structural analyses reveal that E5 contains distinct hydrophobic domains that are essential for its membrane association and protein interactions . Mutations affecting the hydrophobic profile, especially in the first transmembrane domain, significantly alter the protein's subcellular distribution and functional capabilities.

What is the cellular localization pattern of HPV16 E5?

HPV16 E5 primarily localizes to the endoplasmic reticulum (ER) and Golgi apparatus in infected cells. This localization is predominantly determined by its first hydrophobic transmembrane domain. When this domain is disrupted through mutations (such as in the M1 mutant), the subcellular distribution of the protein is significantly modified . The ER/Golgi localization is functionally important as it allows E5 to interact with key proteins involved in cellular processes such as protein trafficking and immune response modulation.

What are the primary functions of HPV16 E5 during viral infection?

HPV16 E5 serves multiple critical functions during viral infection:

  • Suppression of interferon responses, particularly the keratinocyte-specific IFN-κ, through modulation of growth factor signaling pathways (EGFR and TGFBR2)

  • Down-regulation of surface expression of HLA-I molecules, contributing to immune evasion

  • Prevention of viral genome integration into the host genome, which is a frequent step in cancer development

  • Modulation of cellular signaling pathways, including growth factor receptor signaling

These functions collectively contribute to viral persistence and potentially to the oncogenic process in HPV-associated malignancies.

How does HPV16 E5 interfere with interferon signaling pathways?

HPV16 E5 suppresses interferon responses by inhibiting the expression and signaling of keratinocyte-specific IFN-κ. This suppression occurs through E5-induced modifications in growth factor signaling pathways, particularly those involving EGFR and TGFBR2. In cells maintaining the complete HPV16 genome, the presence of E5 results in repression of IFNK transcription .

Phosphoproteomics analysis has revealed that E5 influences the phosphorylation status of various proteins involved in growth factor signaling, which subsequently affects IFN signaling. When E5 is absent (in E5 Stop cells), there is derepression of IFNK transcription and subsequent JAK/STAT-dependent upregulation of several interferon-stimulated genes (ISGs) at both mRNA and protein levels .

The following ISGs show significant expression differences between HPV16+ cells and E5 Stop cells:

Interferon-Stimulated GeneExpression in HPV16+ cellsExpression in E5 Stop cells
OAS2 (p69/p71 isoforms)SuppressedIncreased
Various other ISGsSuppressedIncreased

The ability of E5 to suppress these ISGs was confirmed in experiments showing that E5 expression alone is sufficient to reduce ISG mRNA levels, similar to the effect observed with E6 expression .

What is the role of HPV16 E5 in immune evasion mechanisms?

HPV16 E5 contributes significantly to immune evasion through down-regulation of HLA-I surface expression. This down-regulation occurs through a ternary complex formation between E5, calnexin, and the heavy chain of HLA-I molecules .

The process depends on the presence of calnexin, as demonstrated by studies using calnexin-deficient cell lines. In these cells, despite expressing similar amounts of heavy chain HLA-I, E5-mediated reduction of surface HLA-I is not observed. This indicates that E5 does not directly bind to the heavy chain of HLA-I but rather interferes with the calnexin-dependent processing of HLA-I .

The formation of this ternary complex blocks further trafficking of the HLA-I complex to the plasma membrane, leading to its accumulation in the ER/Golgi of the infected cell. This mechanism effectively reduces the presentation of viral antigens on the cell surface, thereby helping the virus evade detection by the immune system .

How does the protein structure of E5 relate to its immunomodulatory functions?

The immunomodulatory functions of HPV16 E5 are closely tied to its protein structure, particularly its hydrophobic domains. The first putative transmembrane helix of E5 is especially crucial for its ability to down-regulate HLA-I surface expression .

Studies using specific point mutations that disrupt each of the three predicted transmembrane helices have shown that:

  • The M1 mutant (disruption of the first transmembrane domain):

    • Shows altered subcellular localization

    • Has reduced colocalization with calnexin

    • Binds reduced amounts of calnexin in immunoprecipitation assays

    • Fails to down-regulate HLA-I surface expression as effectively as wild-type E5

  • Mutations in other transmembrane domains have different effects, highlighting the specific role of the first hydrophobic domain.

This structure-function relationship indicates that the first hydrophobic domain is primarily responsible for E5's correct subcellular localization, which in turn enables its interaction with calnexin and subsequent immunomodulatory effects .

What is the relationship between HPV16 E5 and viral genome maintenance?

HPV16 E5 plays a critical role in maintaining the viral genome in an episomal state, preventing integration into the host genome. Research has shown that HPV16 genomes lacking E5 tend to integrate at a higher rate in culture over time compared to wild-type genomes .

This function appears to be linked to E5's ability to suppress IFN-κ, suggesting that the interferon-suppressive activity of E5 may be required for long-term maintenance of viral genomes in an episomal state. The integration of the viral genome into the host DNA is a significant step in HPV-induced carcinogenesis, making this function of E5 particularly relevant to understanding HPV persistence and oncogenesis .

What are effective methods for producing recombinant HPV16 E5 protein?

Recombinant HPV16 E5 protein can be effectively produced using in vitro translation systems. Based on the search results, a proven methodology includes:

  • Cloning the HPV16 E5 gene with a 6His-tag for purification purposes

  • Using the Rapid Translation System (RTS proteo Master, Roche) for protein production

  • Conducting the translation reaction at 22°C for 16 hours with continuous stirring

  • Purifying the recombinant protein by affinity chromatography on a Ni-NTA column

The identity and purity of the produced protein should be verified by:

  • Immune Western blot analysis using anti-His monoclonal antibodies

  • Detecting the antigen-antibody reaction using chemiluminescence reagents

  • Quantifying protein concentration using BCA kit

  • Storing the purified protein at -80°C until use

This approach allows for the production of functional recombinant E5 protein that can be used for various experimental applications, including conjugation to antibodies for targeted delivery.

How can I design effective E5 mutation studies to investigate structure-function relationships?

To effectively investigate structure-function relationships of HPV16 E5, consider the following approach for mutation studies:

  • Create targeted point mutations that alter specific characteristics of the protein:

    • Modify the hydrophobic profile by mutating leucine and/or isoleucine residues to proline, aspartate, or arginine

    • Target mutations to disrupt each of the three putative transmembrane helices individually

    • Ensure mutations do not change the total protein length

  • Analyze the modified proteins:

    • Assess hydrophobic profiles using appropriate prediction algorithms

    • Evaluate propensity to form helical structures

    • Determine potential for stably spanning cellular membranes

  • Express mutants in appropriate cell lines:

    • Use codon-optimized versions of E5 for improved expression

    • Verify protein expression levels by immunoblotting

    • Compare migration patterns in SDS-PAGE (variations may indicate differences in hydrophobicity)

  • Functional assessment:

    • Analyze subcellular localization using immunofluorescence microscopy

    • Perform co-localization studies with relevant cellular proteins

    • Conduct immunoprecipitation to assess protein-protein interactions

    • Measure functional outcomes (e.g., HLA-I surface expression) using flow cytometry

This systematic approach allows for detailed analysis of how specific structural elements contribute to E5's various functions.

What experimental approaches can be used to study E5-mediated immune evasion mechanisms?

To study E5-mediated immune evasion mechanisms, consider these experimental approaches:

  • Flow cytometry for surface HLA-I expression:

    • Transfect cells with E5 or E5 mutants tagged with fluorescent markers (e.g., EGFP)

    • Stain for surface HLA-I molecules using specific antibodies

    • Analyze using Kolmogorov-Smirnov (KS) statistical tests to quantify differences in HLA-I expression between E5-expressing and control cells

  • Protein interaction studies:

    • Perform co-immunoprecipitation experiments to detect interactions between E5, calnexin, and HLA-I

    • Use both wild-type and mutant E5 proteins to identify domains responsible for interactions

    • Confirm results with reciprocal immunoprecipitations

  • Subcellular localization analysis:

    • Use confocal microscopy to visualize co-localization of E5 with cellular components

    • Employ specific markers for ER/Golgi compartments

    • Quantify co-localization using appropriate imaging software

  • Functional impact on antigen presentation:

    • Design assays to measure T-cell recognition of cells expressing E5

    • Use reporter systems to quantify antigen presentation efficiency

    • Compare wild-type E5 with mutants to identify critical functional domains

These methods provide comprehensive insights into how E5 interferes with the immune response, particularly through HLA-I downregulation.

What approaches can be used to target HPV16 E5 for therapeutic interventions?

Research indicates that targeting HPV16 E5 to dendritic cells (DCs) can induce therapeutic protection against HPV16-induced tumors. A proven approach includes:

  • Conjugation of E5 protein to dendritic cell-targeting antibodies:

    • Purify anti-DEC-205 monoclonal antibodies (which target DCs)

    • Conjugate purified recombinant E5 protein to these antibodies using chemical cross-linkers

    • The protocol specifically involves:

      • Activating the mAb with SMCC (succinimidyl-4-(N-maleidomethyl)cyclohexane-1-carboxylate)

      • Activating the E5 antigen with Traut's reagent (2-iminothiolate)

      • Mixing the activated components and incubating overnight

      • Removing free antigen by dialysis

      • Verifying the conjugates by SDS-PAGE and Western blot

  • Therapeutic vaccination protocol:

    • First induce tumors in experimental animals using HPV16-expressing cells

    • Then administer the anti-DEC-205:E5 conjugate subcutaneously

    • Include appropriate adjuvants (e.g., Poly I:C)

    • Use proper controls (isotype:E5, free E5, or anti-DEC-205 conjugated to an irrelevant protein)

The effectiveness of this approach was demonstrated in a study where mice treated with anti-DEC-205:E5 conjugate showed 90% tumor reduction by day 30, with 70% of mice achieving complete tumor elimination and remaining tumor-free for up to 100 days. In contrast, control groups developed fast-growing tumors and died within 30 days .

How should I interpret conflicting results regarding E5's role in interferon signaling?

When interpreting conflicting results about E5's role in interferon signaling, consider these methodological approaches:

  • Evaluate experimental models:

    • Cell type differences: HPV16 E5 effects may vary between keratinocytes, transfected cell lines, and in vivo models

    • Context of E5 expression: Results from cells expressing E5 alone may differ from those with the complete HPV16 genome

    • Episomal versus integrated viral genomes: E5 functions differently depending on the state of the viral genome

  • Examine interferon response measurements:

    • Compare basal versus stimulated interferon levels

    • Consider the specific interferon type being measured (IFN-α, IFN-β, or IFN-κ)

    • Note that basal levels of IFN-α and IFN-β are typically very low (CT values of 30-33)

  • Analyze data statistically:

    • For flow cytometry data, use appropriate statistical tests like Kolmogorov-Smirnov

    • For gene expression data, apply paired two-tailed Student's t-test or Wilcoxon matched-pairs signed-ranks test

    • Ensure p-values are properly calculated and reported (significant results typically show p < 0.05)

  • Consider temporal aspects:

    • E5's effects may vary during different stages of infection or cellular transformation

    • Long-term cultures may show different results than short-term experiments

By systematically addressing these factors, researchers can reconcile apparently conflicting results and develop a more comprehensive understanding of E5's complex role in interferon signaling.

What statistical approaches are most appropriate for analyzing E5 mutant functional studies?

When analyzing functional studies of E5 mutants, the following statistical approaches are recommended:

  • For flow cytometry data comparing surface protein expression:

    • The Kolmogorov-Smirnov (KS) test is particularly appropriate as it defines the maximum vertical deviation between two curves (e.g., pEGFP-E5 vs. pEGFP-control) as the statistic D

    • This test is sensitive to differences in distribution shape and is well-suited for flow cytometry data

    • A p-value ≤ 0.001 typically indicates significant differences

  • For comparing mutants to wild-type E5:

    • Paired two-tailed Student's t-test for normally distributed data

    • Wilcoxon matched-pairs signed-ranks test for non-parametric data

    • Apply these tests to both raw percentages of immunoreactive cells and the D statistic from KS tests

  • For protein interaction studies (co-immunoprecipitation):

    • Quantitative densitometry of Western blot bands

    • Normalization to appropriate controls

    • Multiple independent experiments (n ≥ 3) to ensure reproducibility

  • For gene expression analyses:

    • RT-qPCR data should be normalized to stable reference genes

    • Present as fold-changes relative to controls

    • Statistical significance should be determined using appropriate tests based on data distribution

The research indicates that significant E5 effects typically show p < 0.05 across multiple experimental approaches, providing robust evidence for functional differences between wild-type and mutant proteins .

How can I distinguish direct effects of E5 from indirect consequences in experimental systems?

Distinguishing direct effects of HPV16 E5 from indirect consequences requires careful experimental design:

  • Use targeted mutations and domain-specific analyses:

    • Create specific mutations in different domains of E5 (e.g., M1, M2, M3 mutants disrupting each transmembrane helix)

    • Correlate structural changes with functional outcomes

    • Identify which protein domains are necessary for specific functions

  • Employ protein interaction studies:

    • Conduct co-immunoprecipitation experiments to identify direct binding partners

    • Confirm interactions using reciprocal precipitation approaches

    • Use competition assays to verify specificity of interactions

  • Utilize calnexin-deficient versus calnexin-expressing cell lines:

    • The research shows that E5's effect on HLA-I surface expression is dependent on calnexin

    • This experimental system helps distinguish direct binding from indirect effects

    • Both cell types express similar amounts of HLA-I heavy chain, but E5-mediated reduction of surface HLA-I occurs only in calnexin-containing cells

  • Compare full-length HPV16 genome with E5 mutant genome:

    • Use E5 Stop cells (containing HPV16 genome with stop codon in E5 ORF)

    • These genomes can immortalize human foreskin keratinocytes (HFKs) and maintain as episomes with normal E6/E7 expression

    • This system allows distinction between E5-specific effects and those caused by other viral proteins

By systematically implementing these approaches, researchers can confidently distinguish direct molecular actions of E5 from secondary or indirect consequences in experimental systems.

What are promising therapeutic strategies targeting HPV16 E5 functions?

Based on current research, several promising therapeutic strategies targeting HPV16 E5 functions are emerging:

  • Dendritic cell-targeted E5 vaccines:

    • Conjugation of E5 to anti-DEC-205 antibodies has shown significant therapeutic potential

    • This approach induced 90% tumor reduction by day 30 in mouse models

    • 70% of treated mice achieved complete tumor elimination and remained tumor-free for up to 100 days

    • Further development could optimize adjuvant combinations and delivery routes

  • Small molecule inhibitors of E5-protein interactions:

    • Targeting the interaction between E5 and calnexin could restore normal HLA-I trafficking

    • Compounds disrupting the first transmembrane domain interactions would be particularly promising

    • This approach could enhance immune recognition of HPV-infected cells

  • Combination therapies addressing multiple immune evasion mechanisms:

    • Simultaneous targeting of E5, E6, and E7 immunomodulatory functions

    • Combining with checkpoint inhibitor therapies to enhance T-cell responses

    • Integration with standard-of-care treatments for HPV-associated malignancies

  • IFN-κ augmentation strategies:

    • Given E5's role in suppressing IFN-κ, therapies that restore or augment this signaling pathway

    • This could potentially prevent viral genome integration and reduce oncogenic progression

    • May be particularly effective in early-stage infections or precancerous lesions

These approaches offer promising avenues for translating basic research on E5 function into effective therapeutic interventions for HPV-associated diseases.

How might advances in structural biology enhance our understanding of E5 protein interactions?

Advances in structural biology could significantly enhance our understanding of HPV16 E5 protein interactions in several ways:

  • Membrane protein structural determination techniques:

    • Cryo-electron microscopy (cryo-EM) could potentially resolve the structure of E5 in membrane environments

    • Nuclear magnetic resonance (NMR) spectroscopy optimized for membrane proteins could determine solution structures

    • These approaches would provide detailed insights into the three putative transmembrane helices and their interactions

  • Structural characterization of protein complexes:

    • Resolving the structure of the ternary complex between E5, calnexin, and HLA-I heavy chain

    • Understanding the structural basis for how E5's first hydrophobic region mediates these interactions

    • Identifying specific amino acid residues critical for complex formation

  • Computational modeling and simulation:

    • Molecular dynamics simulations of E5 in membrane environments

    • Prediction of conformational changes during protein-protein interactions

    • Virtual screening for compounds that could disrupt key interactions

  • Structure-guided mutational analyses:

    • Designing precise mutations based on structural information

    • Moving beyond the current M1, M2, M3 mutants to more targeted modifications

    • Correlating structural features with specific functional outcomes

These structural biology approaches would provide deeper mechanistic insights into how E5 functions at the molecular level, potentially identifying new therapeutic targets and strategies for intervention.

What are the key unresolved questions regarding HPV16 E5's role in viral pathogenesis?

Despite significant progress in understanding HPV16 E5 functions, several key questions remain unresolved:

  • Temporal dynamics of E5 activity:

    • How does E5 function change during different phases of the viral life cycle?

    • What triggers the transition from immune evasion to potentially oncogenic functions?

    • How do E5 functions evolve during the progression from infection to malignancy?

  • Interaction with other HPV oncoproteins:

    • How does E5 cooperate with E6 and E7 in cellular transformation?

    • Are there redundancies or synergies in their immune evasion mechanisms?

    • Can targeting E5 enhance therapeutic approaches against E6 and E7?

  • Host variation in susceptibility to E5 effects:

    • Do genetic variations in host factors like calnexin affect E5's ability to down-regulate HLA-I?

    • Are there population-specific differences in response to E5-mediated immune evasion?

    • How does the microenvironment influence E5 functions in different epithelial tissues?

  • Relationship between E5's roles in immune evasion and viral genome maintenance:

    • How precisely does suppression of IFN-κ contribute to maintaining the viral genome in an episomal state?

    • What molecular mechanisms connect these seemingly distinct functions?

    • Could targeting this connection provide new therapeutic opportunities?

  • E5 variants and their functional significance:

    • How do naturally occurring E5 variants differ in their immune evasion capabilities?

    • Are certain variants associated with higher oncogenic potential?

    • Could E5 sequence variations serve as prognostic markers for HPV-associated diseases?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.