Recombinant Probable signal peptidase complex subunit 1 (C34B2.10)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Probable Signal Peptidase Complex Subunit 1 (C34B2.10) is a protein derived from the Caenorhabditis elegans gene C34B2.10, which encodes a 12 kDa subunit of the endoplasmic reticulum (ER)-localized signal peptidase complex (SPC). This complex is essential for cleaving signal peptides from nascent proteins during their translocation into the ER lumen . Recombinant versions of this protein are engineered for experimental applications, enabling studies on SPC function, protein trafficking, and viral assembly mechanisms .

Production and Purification

Recombinant C34B2.10 is produced in heterologous expression systems, including E. coli, yeast, baculovirus, and mammalian cells . Technical specifications from suppliers include:

ParameterDetails
Host SystemE. coli, yeast, baculovirus, or mammalian cells
TagN-terminal His tag for purification
Purity≥85% (verified by SDS-PAGE)
ApplicationsEnzyme assays, protein interaction studies, structural biology

Signal Peptidase Complex Activity

The SPC, including C34B2.10, cleaves signal peptides from secretory and transmembrane proteins. This process is critical for protein maturation and ER export .

Viral Assembly Regulation

C34B2.10 homologs (e.g., human SPCS1) regulate Flaviviridae virus propagation by facilitating SPC-mediated processing of viral polyproteins. For hepatitis C virus (HCV), SPCS1 enhances E2-p7 junction cleavage, a step essential for viral assembly .

EGFR Trafficking in C. elegans

In C. elegans, C34B2.10 interacts with the CHORD protein CHP-1 to regulate epidermal growth factor receptor (EGFR) trafficking. Loss of C34B2.10 leads to EGFR mislocalization and disrupted vulval development .

Interaction Network

STRING database analysis reveals functional partners of C34B2.10 in C. elegans :

Interacting ProteinFunctionInteraction Score
hpo-21 (SPCS2)Signal peptidase complex subunit 20.997
K12H4.4 (SPCS3)Signal peptidase complex subunit 30.985
Y54E10BR.5 (SEC11)Catalytic subunit of SPC0.983
dad-1Oligosaccharyltransferase subunit; linked to N-glycosylation0.851
emo-1 (SEC61γ)Translocon component for ER protein import0.802

Mechanistic Studies of ER Processing

Recombinant C34B2.10 is used to dissect SPC’s role in cleaving suboptimal substrates, such as viral polyproteins. Structural modeling and co-immunoprecipitation experiments demonstrate its interaction with unprocessed precursors (e.g., HCV E2-p7) .

Reporter Constructs for Cellular Localization

Fluorescently tagged C34B2.10 (e.g., mCherry fusions) visualizes ER architecture and protein trafficking defects in C. elegans vulval precursor cells .

Drug Discovery

SPCS1 inhibitors are explored as antiviral therapies. Recombinant C34B2.10 provides a model for high-throughput screening .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
spcs-1; C34B2.10; Probable signal peptidase complex subunit 1; Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C34B2.10
Target Protein Sequence
MDGMIAMLPAPLQKLSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVL GASAFTALIILPPWPFLFRKNPIVWHTPAEPQESGDKKKETKKTK
Uniprot No.

Target Background

Function
Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from newly synthesized proteins as they are transported into the lumen of the endoplasmic reticulum.
Database Links

KEGG: cel:CELE_C34B2.10

STRING: 6239.C34B2.10

UniGene: Cel.7734

Protein Families
SPCS1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is C34B2.10 and what is its function in C. elegans?

C34B2.10 (SP12) is the 12 kDa subunit of the C. elegans ER signal peptidase complex . It functions as part of the machinery responsible for cleaving signal peptides from preproteins during or shortly after their translocation across the ER membrane . Signal peptidases like SP12 are critical for cell survival as they release translocated preproteins from the membrane, allowing for proper protein folding and function . Without proper signal peptidase activity, preproteins would accumulate at the membrane, which has been shown to be deleterious for cellular growth .

Why is C34B2.10 commonly used as an ER marker?

C34B2.10 (SP12) has become a widely utilized ER marker in C. elegans research because it reliably localizes to the endoplasmic reticulum and can be visualized when tagged with fluorescent proteins like GFP or mCherry . Studies have confirmed its correct ER localization through coimmunofluorescence with antibodies recognizing the ER retention signal (-HDEL) . Importantly, expression of tagged SP12 does not appear to interfere with development or growth rate of the worms, making it an ideal marker for studying ER dynamics in various tissues and developmental stages . The protein localizes to a reticular tubular network that extends to the cell cortex, resembling the ER architecture observed in yeast and mammalian cells .

How does the signal peptidase complex function in protein processing?

The signal peptidase complex cleaves N-terminal signal peptides from secretory and membrane proteins during their maturation . Signal peptides act as "zipcodes" that mark proteins destined for extracytoplasmic locations and direct them to specific secretion pathways . Once the majority of a preprotein is translocated across the membrane, the signal peptidase cleaves the signal peptide, allowing release from the membrane and correct folding of the mature protein . This process is essential across species, from bacteria to humans, with signal peptidases playing a critical role in protein secretion pathways . In eukaryotes like C. elegans, the signal peptidase complex consists of multiple subunits that work together to recognize signal sequences with high fidelity and catalyze their cleavage .

What are the structural determinants of substrate specificity in signal peptidases like C34B2.10?

Signal peptidases must recognize and cleave specific signal sequences with high fidelity to ensure proper protein processing . Research indicates that the residues surrounding the predicted cleavage site (particularly positions P3-P4′) are crucial for recognition and processing by signal peptidases . For example, studies of the bacterial signal peptidase LepB show that certain amino acids at key positions can inhibit processing. Molecular modeling demonstrates that a tryptophan at the P2 position can anchor itself into the narrow channel of the enzyme's active site, interacting with the catalytic serine residue (Ser-90 in LepB) . These studies provide insights into the structural basis of substrate specificity that likely applies to eukaryotic signal peptidases like C34B2.10 as well. The C-terminal domain of signal peptidases contains the active site and is involved in recognition of the correct cleavage site . Researchers investigating C34B2.10 should consider these structural aspects when studying its activity and designing experiments to manipulate its function.

How do mutations in C34B2.10 affect ER dynamics and protein secretion in C. elegans?

While the search results do not directly address mutations in C34B2.10, we can infer their potential effects based on studies of signal peptidases in other organisms. Since signal peptidases are critical for protein secretion and membrane protein integration, mutations affecting C34B2.10 would likely disrupt ER function and protein trafficking . In fungi, for example, mutations in signal peptidase components lead to growth defects . In C. elegans, where SP12 has been used as an ER marker, significant changes in ER morphology or protein secretion might be expected if C34B2.10 function is compromised. The importance of proper signal peptidase function is highlighted by studies showing that accumulation of unprocessed preproteins at the membrane is deleterious for growth . Therefore, researchers should examine phenotypes related to secretory pathway function, ER stress responses, and organismal development when studying C34B2.10 mutations.

What is the relationship between C34B2.10 and other components of the signal peptidase complex in C. elegans?

Signal peptidase complexes typically consist of multiple subunits that interact to form a functional enzyme . By analogy to other organisms, C34B2.10 likely functions as part of a multi-subunit complex in C. elegans. In fungi like Fusarium oxysporum, four components of the signal peptidase complex (FoSec11, FoSpc1, FoSpc2, and FoSpc3) have been identified and shown to interact . Affinity purification and mass spectrometry experiments have revealed that these four signal peptidase subunits act as a complex, similar to their homologs in S. cerevisiae . While specific data on the interaction partners of C34B2.10 in C. elegans are not provided in the search results, researchers should investigate potential interactions with other ER-resident proteins and putative signal peptidase subunits. Techniques such as co-immunoprecipitation, bimolecular fluorescence complementation (BiFC), or affinity purification combined with mass spectrometry would be appropriate for characterizing these interactions .

What are the optimal methods for generating recombinant C34B2.10 constructs for C. elegans research?

Based on the search results, researchers have successfully generated functional C34B2.10 constructs using several approaches. One effective method involves PCR amplification of the C34B2.10 gene from N2 genomic DNA, excluding the first methionine of the coding sequence . The resulting product can be cloned into appropriate expression vectors, such as those based on the Gateway system (e.g., pENTR/D) . For visualization, C34B2.10 has been successfully fused with fluorescent proteins like GFP or mCherry .

For germ-line expression, vectors containing promoters such as the pie-1 promoter have been used . For expression in other tissues, the dlg-1 promoter has proven effective . When creating fusion proteins, researchers have included linker sequences (e.g., encoding three alanines) between C34B2.10 and the fluorescent tag to ensure proper folding and function .

To generate stable transgenic lines, the MosSCI (Mos1-mediated Single Copy Insertion) method has been successfully employed to create single-copy insertion transgenes . This approach avoids potential artifacts associated with overexpression from extrachromosomal arrays and ensures consistent expression levels across generations.

How can researchers effectively validate the subcellular localization of C34B2.10 in experimental systems?

Validation of C34B2.10 subcellular localization requires multiple complementary approaches to ensure accuracy. Researchers have successfully employed coimmunofluorescence with antibodies recognizing the ER retention signal (-HDEL) to confirm the ER localization of SP12::GFP fusion proteins in C. elegans embryos . This approach verifies that the tagged protein correctly targets to the ER.

For quantitative analysis of colocalization, researchers have calculated the percentage of overlap between C34B2.10 fusion proteins and established ER markers . For example, studies have reported 34% colocalization between SP12::mCherry and certain ER-resident proteins under normal conditions . Changes in this colocalization percentage can indicate alterations in protein trafficking or ER morphology.

When using C34B2.10 as an ER marker, it's important to verify that expression of the fusion protein does not interfere with normal development or cellular functions . Researchers should monitor growth rates, developmental timing, and other phenotypic characteristics to ensure that the experimental system remains physiologically relevant.

What approaches can be used to study the interactions between C34B2.10 and its substrate proteins?

While the search results don't specifically address methods for studying C34B2.10-substrate interactions, we can infer appropriate techniques based on studies of other signal peptidases. Several complementary approaches would be valuable:

  • Surface Plasmon Resonance (SPR): This technique has been successfully used to assess binding affinity between signal peptidases and their peptide substrates . Researchers could immobilize recombinant C34B2.10 on SPR chips and measure binding kinetics with various candidate substrates.

  • Enzyme Activity Assays: In vitro assays with purified C34B2.10 and synthetic peptide substrates can determine cleavage specificity and efficiency . By designing peptides that mimic potential cleavage sites, researchers can identify sequence determinants that influence processing.

  • Molecular Modeling: Computational approaches like flexible peptide docking (e.g., using the CABS-dock web server) have provided insights into how signal peptides interact with the active site of signal peptidases . Similar modeling could predict how different substrates might interact with C34B2.10.

  • Mutational Analysis: Systematic mutation of residues in both C34B2.10 and its substrates, followed by functional assays, can identify critical determinants of recognition and cleavage. This approach has been productive in studies of bacterial signal peptidases .

How should researchers interpret colocalization data when using C34B2.10 as an ER marker?

When interpreting colocalization data involving C34B2.10 as an ER marker, researchers should consider several factors. First, partial rather than complete colocalization with other ER proteins is normal and expected. For instance, studies have observed approximately 34% colocalization between SP12::mCherry and certain ER-resident proteins under normal conditions . The degree of colocalization can vary depending on the specific ER subdomains being examined.

Changes in colocalization patterns can indicate alterations in protein trafficking or ER morphology. For example, in chp-1(lf) mutants, colocalization between LET-23::GFP and SP12::mCherry increased to 64%, suggesting retention of LET-23 in the ER . When analyzing such data, researchers should:

  • Quantify colocalization using appropriate statistical measures (e.g., Pearson's correlation coefficient, Manders' overlap coefficient).

  • Compare results to relevant controls and wild-type conditions.

  • Consider the three-dimensional structure of the ER when interpreting two-dimensional microscopy data.

  • Account for potential artifacts due to protein overexpression or tagging.

What are the key parameters to consider when analyzing signal peptide cleavage by C34B2.10?

Analysis of signal peptide cleavage by C34B2.10 should consider several critical parameters:

  • Cleavage Site Specificity: Signal peptidases recognize specific sequence motifs around the cleavage site . The residues at positions P3-P4′ relative to the cleavage site are particularly important . Researchers should examine these sequences when predicting or analyzing cleavage events.

  • Kinetics of Cleavage: The efficiency of signal peptide processing can vary widely depending on substrate sequence. Some signal peptides are cleaved co-translationally, while others are processed post-translationally . Time-course experiments can reveal these differences.

  • Influence of ER Environment: Signal peptidase activity can be affected by ER stress, calcium levels, and other environmental factors . Researchers should control for these variables when comparing cleavage efficiency across different conditions.

  • Integration with Translocation Pathways: Signal peptidases act on substrates emerging from translocation channels . The timing and efficiency of cleavage may depend on the specific translocation pathway (e.g., Sec or Tat) used by the substrate .

How can researchers distinguish between direct and indirect effects when manipulating C34B2.10 function?

Distinguishing between direct and indirect effects when manipulating C34B2.10 function requires careful experimental design and controls:

  • Rescue Experiments: If knockdown or mutation of C34B2.10 causes phenotypic changes, these should be reversible by expressing wild-type C34B2.10. This approach confirms that observed effects are specifically due to loss of C34B2.10 function .

  • Catalytic Mutants: Creating mutations in the catalytic residues of C34B2.10 can separate its enzymatic activity from potential structural or scaffolding functions. If phenotypes result specifically from loss of catalytic activity, this suggests direct effects on substrate processing.

  • Substrate-Specific Analysis: By examining multiple potential substrates, researchers can determine whether all secretory proteins are equally affected by C34B2.10 manipulation. Differential effects suggest substrate specificity rather than general secretory pathway disruption.

  • Temporal Analysis: Using time-course experiments and inducible expression systems can help establish cause-and-effect relationships. Primary (direct) effects typically occur rapidly after manipulation, while secondary effects develop over longer timeframes.

How has C34B2.10 been used to study ER dynamics during C. elegans embryonic development?

C34B2.10 (SP12) has proven to be a valuable tool for studying ER dynamics during C. elegans embryonic development. Researchers have created transgenic lines expressing SP12::GFP or SP12::mCherry to visualize the ER in early embryos . These markers allow real-time observation of ER morphology and distribution during critical developmental processes.

Studies have confirmed the correct ER localization of SP12::GFP by coimmunofluorescence with antibodies recognizing the ER retention signal (-HDEL) . The expression of these transgenes does not interfere with normal development or growth rate, making them suitable for developmental studies .

What insights about protein secretion have been gained from studying C34B2.10 and other signal peptidases across species?

Studies of signal peptidases across species, including C34B2.10 in C. elegans, have provided several key insights about protein secretion:

How does the function of C34B2.10 in C. elegans compare to signal peptidases in other model organisms?

The function of C34B2.10 in C. elegans appears to be largely conserved with signal peptidases in other model organisms, but with some species-specific features:

OrganismSignal Peptidase ComponentsKey FeaturesComparison to C34B2.10
C. elegansSP12 (C34B2.10) and other uncharacterized subunitsLocalizes to ER membrane; used as ER marker-
S. cerevisiaeSec11, Spc1, Spc2, Spc3Four-subunit complex; essential for viabilityLikely similar multisubunit structure
F. oxysporum (fungus)FoSec11, FoSpc1, FoSpc2, FoSpc3Required for normal growth; subunits interact in complexProbable functional analogy to fungal complex
BacteriaLepB (Type I SPase)Single transmembrane domain; serine-lysine catalytic dyadMore complex in C. elegans with multiple subunits
B. subtilisSipWArchaeal-organism-like signal peptidase with distinct substrate specificityDifferent specificity than eukaryotic SPases

What are the most promising research directions for understanding C34B2.10 function in cellular and developmental processes?

Based on the current knowledge about C34B2.10 and signal peptidases in general, several promising research directions emerge:

  • Comprehensive Identification of Substrates: Developing proteomics approaches to identify the complete set of proteins processed by C34B2.10 would provide insights into its role in various cellular processes. Techniques such as quantitative proteomics comparing wild-type and C34B2.10-deficient cells could reveal substrates whose processing is specifically dependent on this signal peptidase subunit .

  • Structure-Function Analysis: Determining the three-dimensional structure of C34B2.10 and its interactions within the signal peptidase complex would enhance our understanding of its catalytic mechanism and substrate specificity . This could be approached through structural biology techniques such as cryo-electron microscopy or X-ray crystallography.

  • Regulatory Mechanisms: Investigating how C34B2.10 activity is regulated during development and in response to stress conditions would reveal its role in cellular adaptation . Studies could examine post-translational modifications, protein-protein interactions, or changes in expression levels that modulate C34B2.10 function.

  • Integration with Other Secretory Pathway Components: Exploring how C34B2.10 coordinates with other components of the secretory pathway, such as the Sec translocation machinery or ER chaperones, would provide a more comprehensive understanding of protein secretion in C. elegans .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.