Recombinant Probable signal peptidase complex subunit 2 (CBG15767)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
spcs-2; hpo-21; CBG15767; Probable signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
hpo-21
Target Protein Sequence
MSDERITVVNKWDGPTVKNGLDEVVKKILNDKVGWTEQHNLMNLRLLISFIGVAFSAFAC GYDFYAPFPKSKIVLLVCSVSYFICMGVLQLFQWYVEKDCFYEANEVDGKQTRKWAWSSE IKAHDDKYVLSAEFKKEGRSGQGKIIKSIGAYIDNDGEIMIPLVQREVDDLWARLIRSEQ
Uniprot No.

Target Background

Function
A component of the microsomal signal peptidase complex. This complex removes signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.
Database Links

KEGG: cbr:CBG15767

STRING: 6238.CBG15767

Protein Families
SPCS2 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Probable Signal Peptidase Complex Subunit 2 (CBG15767) and what is its function?

Probable Signal Peptidase Complex Subunit 2 (CBG15767), also known as hpo-21 or spcs-2, is a component of the signal peptidase complex that localizes to the endoplasmic reticulum. It participates in the crucial process of intramembrane proteolysis of signal peptides after they have been cleaved from preproteins. Signal peptidase complexes are vital for cell survival as they enable the release of translocated preproteins from the membrane during their transport from cytoplasmic synthesis sites to extracytoplasmic locations .

The protein is an integral membrane protein with sequence motifs characteristic of presenilin-type aspartic proteases. In its natural context, this activity generates signal sequence-derived epitopes that can be recognized by the immune system and participates in processing specific viral proteins such as the hepatitis C virus core protein .

How does Signal Peptidase Complex Subunit 2 differ from Signal Peptidase I?

While both proteins are involved in signal peptide processing, they have distinct roles and characteristics:

FeatureSignal Peptidase Complex Subunit 2Signal Peptidase I
LocationComponent of a larger complexCan function independently
Cleavage specificityAssists in general signal peptide processingCleaves preproteins as they emerge from either Sec- or Tat-translocation pathways
FunctionStructural/auxiliary componentPrimary catalytic component
Evolutionary distributionEukaryotic-specificPresent in prokaryotes and eukaryotes
Inhibition sensitivityLess studiedTarget for specific antibiotics

What is known about the structural determinants of substrate recognition by Signal Peptidase Complex Subunit 2?

The structural basis for substrate recognition by Signal Peptidase Complex Subunit 2 involves specific interactions with signal peptides. NMR studies of related signal peptidases suggest that signal peptides bind to the enzyme in an extended conformation with the cleavage region (-5 to -1) adopting an unstructured conformation. The enzyme appears to recognize a sequence pattern rather than a specific amino acid motif .

Key recognition elements include:

Recent molecular modeling and NMR studies indicate that when the signal peptide docks on the signal peptidase, the cleavage region must be unstructured and exposed for efficient processing. This is consistent with observations that signal peptides bound to dodecylphosphocholine micelles also present unstructured regions at their cleavage sites .

How does the expression system affect the production and quality of recombinant CBG15767?

The choice of expression system significantly impacts both the yield and functional quality of recombinant CBG15767. Based on comparative studies with similar signal peptidase components, the following considerations are important:

Expression SystemAdvantagesLimitationsYield Factors
E. coli (bacterial)High yield, rapid growth, economicalLacks post-translational modifications, potential inclusion body formationGrowth conditions, induction timing, promoter strength
CHO cells (mammalian)Native-like processing, proper foldingHigher cost, slower growth, more complex media requirementsSignal peptide optimization, transfection efficiency, culture conditions
Insect cellsIntermediate complexity, good for membrane proteinsModerate cost, different glycosylation patternsInfection multiplicity, harvest timing, cell density

The choice of signal peptide elements used in the expression vector can also significantly affect protein production levels. Machine learning approaches are now being developed to predict how discrete signal peptide elements will perform when utilized to drive endoplasmic reticulum (ER) translocation of specific proteins .

What are the potential research applications of studying signal peptide processing in disease models?

Signal peptide processing has significant implications for various disease states:

  • Infectious Diseases: Signal peptidase inhibition is a potential target for antimicrobial development. Disruption of signal peptide processing can prevent proper localization of virulence factors in pathogens.

  • Neurodegenerative Disorders: Abnormal processing of specific signal peptides has been implicated in protein misfolding diseases like Alzheimer's disease, where presenilin-like proteases (structurally related to signal peptidases) play key roles.

  • Immune Regulation: Signal peptide-derived epitopes are crucial for immune surveillance. Alterations in signal peptidase activity can affect the presentation of these epitopes to immune cells, potentially contributing to autoimmune conditions.

  • Cancer Biology: Dysregulation of protein trafficking pathways, including signal peptide processing, has been observed in various cancers, affecting cellular signaling and metastatic potential.

Research using recombinant CBG15767 can provide insights into fundamental mechanisms of these processes, potentially identifying novel therapeutic targets or diagnostic markers .

What are the optimal conditions for reconstitution and storage of recombinant CBG15767 protein?

Based on established protocols for similar recombinant proteins, the following conditions are recommended for optimal handling of recombinant CBG15767:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring the lyophilized powder to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot to minimize freeze-thaw cycles

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Store reconstituted protein in working aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C/-80°C with glycerol as a cryoprotectant

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

The reconstituted protein is typically maintained in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps preserve structural integrity and functional activity .

How can researchers design effective assays to measure the enzymatic activity of signal peptidase complex components?

Designing effective assays for signal peptidase activity requires careful consideration of substrate selection, detection methods, and assay conditions:

In vitro Enzymatic Assays:

Assay TypePrincipleAdvantagesConsiderations
Fluorogenic peptide substratesCleavage releases quenched fluorophoreHigh sensitivity, real-time kineticsMay not reflect native substrate complexity
FRET-based assaysMeasures distance changes during cleavageGood for conformational studiesRequires careful probe positioning
Mass spectrometryIdentifies cleavage products directlyPrecise identification of cleavage sitesLower throughput, equipment intensive
ImmunoblottingDetects changes in substrate sizeWorks with native substratesSemi-quantitative, endpoint measurement

For signal peptidase complex subunit 2 specifically, researchers should consider:

  • Using model substrates with known signal sequences from the native organism (C. briggsae)

  • Including appropriate cofactors that may be required for complex assembly

  • Controlling detergent concentrations carefully, as these membrane proteins are sensitive to their lipid environment

  • Incorporating negative controls with known signal peptidase inhibitors

  • Validating results with multiple methodological approaches

These assays can help determine kinetic parameters, substrate specificity, and the effects of various conditions on enzymatic activity .

What techniques can be used to study the interaction between signal peptidase complex subunits and their substrates?

Several complementary techniques can be employed to study the interactions between signal peptidase complex subunits and their substrates:

Biophysical Methods:

  • Surface Plasmon Resonance (SPR): Provides real-time binding kinetics and affinity constants

  • Isothermal Titration Calorimetry (ITC): Measures thermodynamic parameters of binding

  • NMR Spectroscopy: Offers atomic-level details of interaction sites and conformational changes

Structural Biology Approaches:

  • X-ray Crystallography: Provides high-resolution structures of complexes

  • Cryo-Electron Microscopy: Particularly useful for larger complexes or membrane-associated assemblies

  • Computational Modeling: Predicts binding modes and interaction energies

Biochemical Methods:

  • Co-immunoprecipitation: Identifies interacting partners in cellular contexts

  • Crosslinking followed by Mass Spectrometry: Maps interaction interfaces

  • Yeast Two-Hybrid or Mammalian Two-Hybrid: Detects protein-protein interactions in vivo

Recent NMR studies with related signal peptidases have shown that signal peptides bind to the enzyme with the cleavage region adopting an unstructured conformation, facilitating access to the active site. This structural flexibility appears to be important for efficient substrate recognition and processing .

How can researchers address contradictory findings in signal peptide processing studies?

When faced with apparent contradictions in the literature regarding signal peptide processing, researchers should systematically evaluate several factors:

  • Experimental Context:

    • Different expression systems (bacterial vs. mammalian)

    • In vitro vs. in vivo studies

    • Recombinant vs. native protein contexts

  • Methodological Variations:

    • Assay conditions (pH, temperature, ionic strength)

    • Substrate variations (synthetic vs. natural, truncated vs. full-length)

    • Detection methods (direct vs. indirect measurement)

  • Data Interpretation Strategies:

    • Normalize contradictory findings using standardized metrics

    • Apply context analysis to identify experimental conditions driving differences

    • Consider organism-specific variations in signal peptide processing

A systematic approach to resolving contradictions might involve creating a structured database of claims from the literature, annotating experimental conditions, and identifying patterns that explain apparent discrepancies. Alamri and Stevenson's work on contradiction detection in biomedical literature provides a framework for such analyses .

Text mining techniques can help flag potentially contradictory claims for further investigation. When contradictions are identified, researchers should consider replicating key experiments under controlled conditions to directly compare outcomes .

What statistical methods are most appropriate for analyzing signal peptide prediction accuracy?

When evaluating the accuracy of signal peptide prediction algorithms or experimental data related to signal peptidase activity, the following statistical approaches are recommended:

For machine learning approaches to signal peptide prediction, cross-validation strategies (especially leave-one-family-out validation) are particularly important to prevent overfitting to known signal peptide families. When comparing algorithms, statistical significance should be assessed using appropriate tests (e.g., McNemar's test for paired nominal data) .

Additionally, when analyzing experimental data on signal peptide processing, researchers should consider coefficient of variation (CV) as a measure of relative variation, which has been shown to correlate strongly with certain biological outcomes in related systems .

How can potential off-target effects be identified when studying signal peptidase inhibitors?

Identifying off-target effects of signal peptidase inhibitors requires a multi-faceted approach:

  • Biochemical Profiling:

    • Testing inhibitor specificity against a panel of related proteases

    • Determining IC50 values across multiple enzyme classes

    • Evaluating structure-activity relationships to identify problematic chemical moieties

  • Cellular Assays:

    • Global proteomics to identify changes in protein abundance beyond expected targets

    • Secretome analysis to detect broad disruption of protein secretion

    • Cell viability testing across multiple cell types to identify differential toxicity

  • Target Validation Approaches:

    • Use of CRISPR/Cas9 knockdown to compare phenotypes with inhibitor treatment

    • Resistant mutant generation to confirm on-target activity

    • Complementary approaches using antibodies or other binding molecules

Off-target effects are particularly important to consider when studying signal peptidase inhibitors, as these enzymes participate in fundamental cellular processes. Researchers should incorporate negative controls such as inactive analogs with similar physicochemical properties to help distinguish specific from non-specific effects .

What emerging technologies might enhance our understanding of signal peptidase complex function?

Several cutting-edge technologies are poised to significantly advance our understanding of signal peptidase complex function:

  • Cryo-Electron Tomography: This technique can visualize native signal peptidase complexes within their membrane environment at near-atomic resolution, providing insights into their architectural organization and substrate interactions.

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET): By labeling individual components of the signal peptidase complex and their substrates, researchers can track conformational changes and processing events in real-time.

  • Proximity Labeling Proteomics (BioID/APEX): These approaches can map the dynamic protein interaction landscape around signal peptidase complexes during active processing.

  • Microfluidic Systems: Devices that reconstitute membrane protein complexes in lipid bilayers can enable high-throughput functional studies under controlled conditions.

  • AI-Driven Protein Engineering: Machine learning approaches are being developed to predict how specific signal peptide elements will perform with particular proteins, enabling rational design of optimized expression systems .

  • Genome-Wide CRISPR Screens: Systematic genetic perturbation can identify novel regulators and interactors of signal peptidase complexes.

These technologies, particularly when combined, promise to reveal the dynamic nature of signal peptidase function beyond static structural studies.

How might synthetic biology approaches be applied to engineer novel signal peptide processing systems?

Synthetic biology offers exciting possibilities for engineering signal peptide processing systems with enhanced or novel properties:

  • Designer Signal Peptides: Creating optimized signal peptides for specific applications:

    • Enhanced secretion efficiency for biopharmaceutical production

    • Targeting to non-native compartments

    • Programmable processing kinetics for controlled release

  • Engineered Signal Peptidase Complexes:

    • Modified substrate specificity for orthogonal processing pathways

    • Temperature or chemical-responsive activity for inducible systems

    • Reduced immunogenicity for therapeutic applications

  • Cell-Free Processing Systems:

    • Reconstituted minimal processing machinery for in vitro applications

    • Incorporation into artificial cell systems or bioreactors

Current research has demonstrated that machine learning can be used to predict how discrete signal peptide elements will perform for specific protein products in mammalian cell contexts. This approach, combined with targeted design rule-based in vitro testing, can rapidly identify product-specific signal peptide solutions from minimal screening spaces .

For complex molecular formats like multichain antibodies, optimizing the signal peptide for each chain independently can significantly enhance production titers compared to using the same signal peptide for all components .

What are the implications of signal peptide research for developing novel therapeutic approaches?

Signal peptide research has several promising therapeutic applications:

  • Antimicrobial Development:

    • Targeting bacterial signal peptidases to disrupt virulence factor secretion

    • Developing narrow-spectrum antibiotics with reduced resistance potential

    • Creating combination therapies targeting multiple steps in protein secretion

  • Protein Misfolding Diseases:

    • Modulating signal peptide processing to reduce aggregation-prone protein variants

    • Developing therapies for disorders involving presenilin-like proteases (related to signal peptidases)

    • Enhancing clearance of misprocessed proteins

  • Immunomodulatory Approaches:

    • Engineering signal peptide-derived epitopes for vaccine development

    • Targeting abnormal signal peptide processing in autoimmune conditions

    • Enhancing presentation of tumor-associated antigens

  • Protein Replacement Therapies:

    • Optimizing signal peptides for improved production and delivery of therapeutic proteins

    • Creating conditionally activated therapeutic proteins through engineered signal peptide cleavage

Research into the hepatitis C virus core protein processing by signal peptide peptidase has already revealed potential therapeutic targets, demonstrating how fundamental research on signal peptidase complexes can translate to clinical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.