Recombinant Probable signal peptidase complex subunit 2 (Y37D8A.10)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spcs-2; hpo-21; Y37D8A.10; Probable signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
hpo-21
Target Protein Sequence
MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFAC
GYDYYEPFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSE
IKAHDDKYTLSAEFKKEGRSGQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ
Uniprot No.
Target Background
Function
A component of the microsomal signal peptidase complex. This complex removes signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.
Database Links
Protein Families
SPCS2 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
